KEGG   Arthrobacter sp. FB24: Arth_3863Help
Entry
Arth_3863         CDS       T00421                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
art  Arthrobacter sp. FB24
Pathway
art00520  Amino sugar and nucleotide sugar metabolism
art00550  Peptidoglycan biosynthesis
art01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_3863
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Arth_3863
Enzymes [BR:art01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Arth_3863
Peptidoglycan biosynthesis and degradation proteins [BR:art01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Arth_3863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_19 HTH_37 HTH_25 YdaS_antitoxin Sigma70_r4 HTH_26 HTH_23
Motif
Other DBs
NCBI-ProteinID: ABK05238
JGI: Arth3863
UniProt: A0K1R8
Position
complement(4345922..4347445)
Genome map
AA seq 507 aa AA seqDB search
MTQETAEHVGLLLRDARGEKGWTQGQLAAELGTSQSAIARMEQGKQNLSLKMIQRLEAIV
GRSIVKVGRPQMTHLRVEGGRTLSGSVDVNSSKNAGVALLCASLINRGTTTLRRLARIEE
VNRIVEVLTSIGVECTWLNANDLQIRRPAVLDLDSMDVEAARRTRSVIMLLGPLLDESAE
YRLPYAGGCDLGTRTVEPHMQALRQFGLSVEATSGFYSVQAPPADGDNRTFVLSERGDTV
TENAIMAAAHRRGTTVIRNASPNYMVQDLCFYLQGLGVKIDGVGTTTLKITGLPSIDVDI
EYFPSEDPIEAMSLITAGIVTNSEVTIRRVPIEFMEIELATLEQMGQELEISGEYFARNG
RTRLVDVTTKPSALHAPTDKIHPMPFPGLNIDNLPFFAVIAANAEGQTMIHDWVYENRAI
YLTELNKLGARVQLLDPHRIYVNGPTRWRAAEVGCPPALRPAACILLAMLAARGVSELRN
IYVIERGYEDLAERLNTIGAKIEYFQD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagagactgctgaacatgtaggcctgctgctccgcgatgcccgcggggagaag
ggctggacccagggacagctggccgccgagctaggcaccagccagagcgccatcgcccgg
atggaacagggcaagcagaacctcagtctcaaaatgatccagcggctcgaggccattgtg
ggccgcagcatcgtcaaagtgggccggccgcagatgacacacctccgggtggagggcggc
cgcactctgtccggttcggtggacgtcaacagcagcaagaacgcaggagttgcccttctc
tgtgccagcctcatcaaccgcggcaccaccacgctgcgccggctggcccggatcgaggaa
gtgaaccggatcgtggaggtgctcaccagcatcggcgtcgaatgcacctggctcaatgcc
aacgatctgcagatccgccgccccgccgtgctggacctggattccatggacgtggaggct
gcccgccgcacccgcagcgtgatcatgctgctggggccgctcctggacgagtccgcggag
taccgtctcccgtacgcgggcggctgcgacctcggcacccgcaccgtggagccgcacatg
caggccctgcgccagttcggcctgtccgtggaagccacctccggcttctattcggtgcag
gcaccgccggccgacggcgacaaccgcacctttgtgctgagcgaacgcggtgacacggtc
accgagaatgccatcatggcggccgcccaccgccgcggcaccaccgtgatccgcaacgcc
agcccgaattacatggtccaggatctctgcttctacctgcagggcctcggcgtgaagatc
gacggcgtggggaccaccaccctgaagatcaccgggctgccgtccatcgacgtcgacatt
gaatacttcccgtccgaggacccgatcgaagcgatgagcctcatcaccgccggcatcgtg
accaattccgaggtcaccattcgccgggtccccattgagttcatggaaatagaactcgcc
accctggagcagatgggccaggaactggagatctccggcgagtactttgcccgtaacggc
cgcacccggctggtggatgtcaccaccaaaccctccgcattgcatgccccgacggacaag
atccaccccatgccgttccccggcctgaacatcgacaacctgccgttcttcgccgtcatt
gccgccaacgccgaaggccagaccatgatccacgactgggtctacgagaaccgtgccatc
tacctcaccgagctgaacaagctcggggcccgcgtccagctgctggatccgcaccggatc
tacgtcaacggacccaccaggtggcgtgccgccgaggtgggctgcccgcccgccctccgc
ccggccgcatgcatcctgctggccatgctggccgcccgcggggtttcggagctgcgcaac
atctacgtgatcgagcgcgggtacgaggacctggccgagcggctcaacaccatcggcgcg
aagatcgaatacttccaggactga

DBGET integrated database retrieval system