KEGG   Arthrobacter sp. FB24: Arth_3917Help
Entry
Arth_3917         CDS       T00421                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
art  Arthrobacter sp. FB24
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arth_3917
  Lipid metabolism
   00600 Sphingolipid metabolism
    Arth_3917
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arth_3917
Enzymes [BR:art01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Arth_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4420956..4424018)
Genome map
AA seq 1020 aa AA seqDB search
MPVEPTTSSLSSAAGRGAGPGSEAAVRQAVHAPERILDVAAEQVAALASVAPPRGTTPAR
AYLVSDAPRLPLNGVWKFRLHAGIRQAPHDGWQSGGDRPDFGDLPVPSSWPMHGHGTPWY
TNVQFPFAVEPPHVPDANPVGDLFVEFEAGPEYFPSALIRFDGIESAGTVWLNGTLLGTT
RGSRLAHEFDATGVLVPGRNVLAVQVAQFSAASYVEDQDMWWLPGIFRDVTLQARPSEGL
DDVFVHADYDHRSGEGILRVEASRAGQPAAAVVRIPELGLEVPAGEERRLPGIEPWSAEL
PRLYDATVSTTGETASVQLGFRTISIEDAQFKVNGQRILLRGVNRHEHHPKLGRVVPREV
MESELRLMKQHNINAIRTSHYPPHPDFLALADQLGFYVVLECDLETHGFEQGGWQQNPSA
DPQWQQALVDRMSRTVERDKNHASVVMWSLGNEAGTGENLAAMSSWTKLRDPSRPIHYEG
DWSSAHVDVYSRMYASQAETELIGRGVEPPLDDADLDARRRAMPFVLCEYVHAMGNGPGG
MSEYQELFHRHPRLMGGFVWEWLEHGITRTAPDGQEYFVYGGDFGEEVHDGNFVTDGLVD
ANRVPRPGLLDFKKVIEPLTIDVAADWSGFSLTNRFDFADTSGLEFRYSVEADGVTVDGG
PVDVAPVAPHESADLRLPAGLLERAGLAPAVLTVRAVLKEDAAWVDAGHEVAWGQKSANV
RVAPVPAATSAVQVDGGLLRLGPAAFDRATGSLVRLGDTAVEGLRLLLWRAPTDNDLGAE
WGSPDPRPVATQWLDAGLNRMHARLVGISSRPAAGGGDELVVRTRVAAAGKQFGVLAEYA
WTSDGSSVSVRTTVTPDGSWVNAGWPVPWARIGVELVMGSAAKSVEWFGQGPHHSYPDTG
QGTRLGWYDLPLKDLDVEYVRPQESGARSGVYSAALELDAGRLTIGGEPFALTVRPYSLA
ALEAATHRPDLIPDGRTYVYLDHAVLGVGTAACGPGVLEGYRLAPREADFSLVFGVTQST
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgagcccacaacatccagcctctcctccgctgcgggccgcggcgctggaccc
gggtccgaggcagcggtcaggcaggcggtgcacgccccggagcggatcctcgacgtcgcc
gccgagcaggtggccgcactcgcttccgtagccccgccacggggcacgacgccggcacgg
gcctaccttgtgagtgatgccccgcgtctgccgctgaacggtgtgtggaagttcaggctt
cacgcgggcatccggcaggcgccacacgacggctggcagtcgggcggcgatcgtccggat
ttcggcgacctcccggtaccgtccagctggcccatgcacggccacgggacgccctggtac
acgaacgttcagttccccttcgccgtggaaccgccgcatgttcctgacgccaatcccgtc
ggcgatctcttcgtcgagtttgaggcgggcccggagtacttcccgtcagccttgatccgc
ttcgacggcatagaatcggccggaactgtatggctgaacggcaccttgcttggcaccaca
cgcggcagccggctcgcccacgaattcgatgccacgggtgtgctggtaccgggacggaac
gtgcttgcagtccaagtggcgcagttctcggcagccagctatgtggaagaccaggacatg
tggtggctgcccggcatcttccgggatgtgacgctgcaggcgcggccgtcggaggggctc
gacgacgtcttcgtccacgctgactatgaccatcgcagcggcgaaggcatcctccgcgta
gaggcgagccgggcagggcagccggctgccgccgtcgtgcgcatccctgaactggggctg
gaagtgcccgccggggaggagcgtcggctcccgggcatcgagccgtggtcggcagaattg
ccgcggctgtacgacgccaccgtcagcaccacgggggagaccgcctcggtgcagctcggc
ttccgcaccatcagtatcgaggatgcccagttcaaggtgaacggccagcggatcctgctc
cgaggcgtcaaccgccacgaacaccatcccaagctgggccgcgtggtgcccagggaggtc
atggaaagcgaactgcggctgatgaagcagcacaacatcaacgccatccggacctcgcac
tacccgccgcacccggacttcctggcgctggcggaccaacttggcttctacgtggtcctt
gaatgcgacctcgaaacgcatggcttcgaacaaggcggctggcagcagaatcccagtgcc
gatccgcagtggcagcaggccctcgtggaccgaatgtcccggaccgtggagcgcgacaag
aatcacgcgtcggtggttatgtggtccctgggcaacgaggccggcacgggcgaaaacctt
gcagcgatgtccagctggaccaaactccgcgacccctccaggcccatccattacgagggc
gactggagctccgcccacgtggacgtatattcgcggatgtatgcaagccaggcggaaacg
gagctgatcggccgtggcgtggaacctcctttggatgacgcggaccttgacgcgcggcgg
cgcgccatgccgttcgtcctgtgcgagtacgttcacgccatgggcaacggcccggggggc
atgtccgaataccaggaactttttcaccggcacccgcggctgatgggcggctttgtgtgg
gagtggctggagcatggcatcacccgaacggctcctgacgggcaggaatacttcgtctat
ggcggcgacttcggcgaggaagtccacgacggaaacttcgtcactgacggcctggtggat
gccaaccgggtgccgcgcccgggcctgctggatttcaagaaggtcatcgagccgctaacc
attgacgtggcggcggactggtccgggttctcgctcacgaaccgcttcgatttcgccgac
acatcggggctggagttccgctactctgtggaggccgacggcgtcacggtcgacggcggt
ccggttgacgttgcgcctgtggcgccgcacgaatcagccgacctccggttgccggccggg
ctgctggaacgagcggggctggctcctgccgtgctgacggtcagggcagtcctcaaggaa
gacgccgcctgggtggacgcgggccacgaagttgcgtggggccagaagtctgccaatgtg
cgggtggctccggtgccggcggcaacttccgccgtgcaggtggacggtggcctccttcgc
ctggggccggctgccttcgatcgcgcgacgggttcgcttgttcggctgggcgacactgca
gtcgaggggcttcgactcctgctgtggcgtgcacccacggataatgatcttggggcggag
tggggtagcccggatccccgcccagtagccacacagtggctggatgcgggactcaaccgg
atgcacgcccggcttgtcggcatttcctcccggcccgcggcaggcggcggggacgagctg
gtggtgcggacgcgggttgcagcggcaggtaagcaattcggggtgctggccgaatacgcc
tggaccagtgacggctccagtgtcagcgtgcggacaacggtcacacccgacggttcgtgg
gtcaacgccggctggccagtgccgtgggcgcgcataggagtggaactcgtgatgggttcg
gccgccaagtccgtggagtggttcggccaggggccgcaccacagttacccggatacaggc
cagggcaccaggcttggctggtacgacttgcccttgaaggacctggacgtggagtacgtc
cggccccaggaatcgggcgcccgttccggcgtgtactcggcagcgttggagctcgacgcc
ggccggcttaccatcggcggcgagccgttcgcactcaccgtgcgcccctacagcctggcg
gcactggaagccgccacccatcgcccggaccttattccggacggccgcacctacgtgtac
ctcgatcacgccgtactcggagtcggaactgcggcctgcggtccgggggtgctggaaggt
taccggctggcgccgcgggaagccgacttctcgttggtctttggtgtgactcagtccaca
tag

DBGET integrated database retrieval system