KEGG   Aeromonas salmonicida: ASA_0032Help
Entry
ASA_0032          CDS       T00500                                 

Gene name
lypA
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
asa  Aeromonas salmonicida
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ASA_0032 (lypA)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ASA_0032 (lypA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34295..35275)
Genome map
AA seq 326 aa AA seqDB search
MTNPYPLTSEAEVPALYQQTLPDFWRTHAIEGEFKARDGVTIRYAALRQAKVDRAIVIVN
GRVESYLKYQELAWDLWRQGYSLYLIDHRGQGLSDRMLADKQKGYVADFEDYVVDLKQFH
DQVIMADQPAKLFLLAHSMGGAISALYLERWPDDIKAAVLSSPMMGINLGGLPKWLAQGL
AASIDTVGSWLGEPPYGPGQGSYQSHEFADNGLSHSAPRYQAFRDLYEQHPQIKLGGVTA
HWIREGIAAGDTAIAAADRIKTPLLLLQAGEDSVVDNAAQDAFCAKARCEGGKPLRIEGA
WHELFIEADPQRQAALSATLAFFERF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaatccctatccgctgacctccgaagccgaggtccccgctctttaccagcaaacg
ctgcccgacttctggcgtacacatgctatcgagggggagttcaaggccagagacggcgtc
accatccgctatgctgccctgcgccaggccaaggtggatcgcgccatcgtcatcgtcaat
ggtcgggtcgagagctatctcaagtatcaggaactggcctgggatctgtggcgccagggc
tacagcctctatctcatcgatcatcggggacagggcttgtccgaccgtatgctggccgac
aagcagaaaggctatgttgctgatttcgaagattatgtggtggatctcaaacagttccac
gaccaggtcatcatggcagaccagcccgcaaagctgttcctgctggctcactccatgggc
ggtgccatctcggcgctttacctggaacgctggccggatgatatcaaggcggccgtgctc
tcctcccccatgatgggcatcaacctcggcggtctgcccaaatggctggcacaggggctc
gcggccagcatagacactgtcggcagctggctgggcgaaccaccctatggtcccggccaa
ggcagctaccagtcacacgaatttgccgataatggcctgagccacagcgcgccgcgctat
caggcgtttcgcgatctctacgaacagcacccgcaaatcaagctggggggggtgacagca
cactggatccgcgaagggatagccgccggagataccgccattgccgccgcagatcggatc
aagacgccactgctgctgctgcaggcgggggaagacagcgtggtggataatgccgcccag
gatgctttctgtgccaaggccagatgtgaagggggcaagccgctgcggatagagggcgcc
tggcatgagctgtttatcgaggcagaccctcagcgtcaggccgcactgagcgcgaccctg
gcgttcttcgagcgcttctag

DBGET integrated database retrieval system