KEGG   Aeromonas salmonicida: ASA_0437Help
Entry
ASA_0437          CDS       T00500                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
asa  Aeromonas salmonicida
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(454570..455079)
Genome map
AA seq 169 aa AA seqDB search
MTRIYISLGSNIEREHHIRAGLDALHAEFGELTVSRVFESEAVGFAGRPFYNLVVGADTD
MPLATLCQRLRAMEFAHGREPDAKKFAPRTLDLDLLLYGDLVCDVPVALPRGEILTNAFV
LWPLAELAPSLHHPVDGRTLDELWQGYDKASQRLNPIPFHWEARELQHH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatctacatcagcctgggttccaatatcgagcgggagcaccatatccgcgcc
ggtctcgatgccctgcatgccgaatttggcgagctcaccgtctcccgggtattcgagagc
gaggcggttggctttgccggtcgacccttctacaacctggtagtcggcgccgacacagat
atgccgctggccaccctgtgccaacggctgcgtgccatggagtttgcccacggccgcgag
ccggatgccaagaagtttgctccgcgcaccctggatctggatctgctgctctatggcgat
ctggtctgcgatgtaccggtcgcgctaccccgtggcgagatcctcaccaatgccttcgtc
ctctggccgctggccgagctggcaccgagcctgcaccacccggtcgatggccgcacgctg
gacgaactgtggcaaggttatgacaaggcatcccagcgactcaaccccattccctttcac
tgggaagcgcgcgagctgcagcatcactga

DBGET integrated database retrieval system