KEGG   Aeromonas salmonicida: ASA_0478Help
Entry
ASA_0478          CDS       T00500                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asa  Aeromonas salmonicida
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488569..489954)
Genome map
AA seq 461 aa AA seqDB search
MQYRFPETFWWGSASSAAQAEGASLQGGKAPTIWDHWFEQAPNRFHQQIGPAQTSGFYEY
FRDDVRLLRQLGHNSFRTSIAWARLIPAGRGEPNPEAVAFYDAMLDELKAEGIEPFICLF
HFDMPMSMQSLGGWESREVVAAYAEFAETCFRLFGHKVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAATVAYHTMLAHAMAVQRYRALGQDGQIGIILNLTPSYPRSQHPADLKAAN
IADLMFNRSFLDPAVKGEYPAELVSLLKEYDQLPACEAGDQALLAAGKIDLLGINYYQPR
RVKARSNAVNPASPFMPEWFFDHYEMPGRKMNPHRGWEIYEQGIYDILVNLRDHYGNIPS
YISENGMGVEGEAKFKGPDDQIQDDYRIGFIRDHLIWLHKALEESCQCRGYHLWTFIDNW
SWSNAYKNRYGFIELELESQTRRIKKSGQWFATAAREHGFN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgttttcctgaaacgttctggtggggcagcgcctcctcagccgcacaagcc
gaaggcgccagcctgcagggtggcaaggccccgaccatctgggatcactggtttgaacag
gcccccaaccgctttcaccagcagattggcccagctcagacctccggtttctatgaatat
tttcgcgacgatgttcgcttgctgcgccagctcggtcacaacagctttcgcacctccatc
gcctgggcacggctgatcccggcagggcggggagagcccaatccggaagcagtggctttc
tatgacgccatgctcgacgaactcaaggccgaggggatcgagcccttcatctgcttgttc
cacttcgacatgccgatgagcatgcagtccctggggggctgggagagtcgggaggtggtc
gccgcctacgccgaatttgccgagacctgcttcagattgttcggtcacaaggtcaagcac
tggttcactttcaacgaacccatagtgccggtggagggaggttacctctacgacttccac
tacccgaacgtggtggattttcgccgcgccgccacagtggcctatcacaccatgctggcc
catgccatggcagtgcagcgttaccgtgccctcggccaggatggccagatcggcatcatc
ctcaacctgacgccctcctatccgcgctcgcagcatccggcggatctgaaggcggccaac
attgccgatctgatgttcaaccgcagcttcctggatccggcggtcaaaggagagtacccg
gccgaactggtgtcactgctcaaggagtatgaccagctgcccgcctgcgaagcgggagat
caggcactgctggcagcaggcaagatcgacctgctggggatcaactattaccagccacgc
cgggtcaaggcccgcagcaatgcggtcaaccctgccagccccttcatgccggagtggttc
ttcgaccactacgagatgccgggtcgcaagatgaacccgcaccggggctgggagatctac
gaacaggggatctacgacatcctcgtcaacttgcgcgaccactacggcaacattccgagc
tacatctcggagaacggcatgggggtcgaaggcgaggccaagttcaaggggccggatgac
cagatccaggatgactaccgcatcggctttatacgggatcacctcatctggttgcacaag
gcgctggaagaaagctgtcagtgccggggttatcacctctggacctttatcgacaactgg
tcgtggagcaacgcctacaagaaccgctacggctttattgaactggagctggagagccag
acccgacgcatcaaaaagagcggtcagtggtttgcgaccgcagcccgcgagcacggtttc
aactga

DBGET integrated database retrieval system