KEGG   Aeromonas salmonicida: ASA_0478Help
Entry
ASA_0478          CDS       T00500                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asa  Aeromonas salmonicida
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_0478
Enzymes [BR:asa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ASA_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488569..489954)
Genome map
AA seq 461 aa AA seqDB search
MQYRFPETFWWGSASSAAQAEGASLQGGKAPTIWDHWFEQAPNRFHQQIGPAQTSGFYEY
FRDDVRLLRQLGHNSFRTSIAWARLIPAGRGEPNPEAVAFYDAMLDELKAEGIEPFICLF
HFDMPMSMQSLGGWESREVVAAYAEFAETCFRLFGHKVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAATVAYHTMLAHAMAVQRYRALGQDGQIGIILNLTPSYPRSQHPADLKAAN
IADLMFNRSFLDPAVKGEYPAELVSLLKEYDQLPACEAGDQALLAAGKIDLLGINYYQPR
RVKARSNAVNPASPFMPEWFFDHYEMPGRKMNPHRGWEIYEQGIYDILVNLRDHYGNIPS
YISENGMGVEGEAKFKGPDDQIQDDYRIGFIRDHLIWLHKALEESCQCRGYHLWTFIDNW
SWSNAYKNRYGFIELELESQTRRIKKSGQWFATAAREHGFN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgttttcctgaaacgttctggtggggcagcgcctcctcagccgcacaagcc
gaaggcgccagcctgcagggtggcaaggccccgaccatctgggatcactggtttgaacag
gcccccaaccgctttcaccagcagattggcccagctcagacctccggtttctatgaatat
tttcgcgacgatgttcgcttgctgcgccagctcggtcacaacagctttcgcacctccatc
gcctgggcacggctgatcccggcagggcggggagagcccaatccggaagcagtggctttc
tatgacgccatgctcgacgaactcaaggccgaggggatcgagcccttcatctgcttgttc
cacttcgacatgccgatgagcatgcagtccctggggggctgggagagtcgggaggtggtc
gccgcctacgccgaatttgccgagacctgcttcagattgttcggtcacaaggtcaagcac
tggttcactttcaacgaacccatagtgccggtggagggaggttacctctacgacttccac
tacccgaacgtggtggattttcgccgcgccgccacagtggcctatcacaccatgctggcc
catgccatggcagtgcagcgttaccgtgccctcggccaggatggccagatcggcatcatc
ctcaacctgacgccctcctatccgcgctcgcagcatccggcggatctgaaggcggccaac
attgccgatctgatgttcaaccgcagcttcctggatccggcggtcaaaggagagtacccg
gccgaactggtgtcactgctcaaggagtatgaccagctgcccgcctgcgaagcgggagat
caggcactgctggcagcaggcaagatcgacctgctggggatcaactattaccagccacgc
cgggtcaaggcccgcagcaatgcggtcaaccctgccagccccttcatgccggagtggttc
ttcgaccactacgagatgccgggtcgcaagatgaacccgcaccggggctgggagatctac
gaacaggggatctacgacatcctcgtcaacttgcgcgaccactacggcaacattccgagc
tacatctcggagaacggcatgggggtcgaaggcgaggccaagttcaaggggccggatgac
cagatccaggatgactaccgcatcggctttatacgggatcacctcatctggttgcacaag
gcgctggaagaaagctgtcagtgccggggttatcacctctggacctttatcgacaactgg
tcgtggagcaacgcctacaagaaccgctacggctttattgaactggagctggagagccag
acccgacgcatcaaaaagagcggtcagtggtttgcgaccgcagcccgcgagcacggtttc
aactga

DBGET integrated database retrieval system