KEGG   Aeromonas salmonicida: ASA_0599Help
Entry
ASA_0599          CDS       T00500                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
asa  Aeromonas salmonicida
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASA_0599 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASA_0599 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASA_0599 (thrC)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ASA_0599 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604357..605568
Genome map
AA seq 403 aa AA seqDB search
MPYSYLSHLRCSKTGDIHDADQPQQLSQVGAPLLASYDLEALKKVWHPAALLGRPATLWR
YHELLPVRDPAQWVTLGEGLTPLLPLRALGKQVGIPDLWMKDESIIPTGSFKARGAAVGI
SRARELGVTHFAMPTNGNAGAAWALYGARAGLRSTIVMPQEAPAITRLETSLAGARLYLV
DGLISDAGRQVAQAVVDQSLFDASTLKEPYRIEGKKTMGLEIAEQLGWKLPDVIIYPTGG
GVGLIGIYKALRELQELGWVKGDLPRLVAVQASGCAPIVQAWQQGASESSFWPDSQTLAF
GINVPKALGDFLVLDALYRTNGCAIAVDDRAIKAEIRQLASLEGSFVCPEGAAAFAAARQ
LRESGWIKGGEQVVVLNTGAGIKYPDAITVLPQRLRRDGRIPA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacagctacctatcacatctgcgttgcagcaagaccggcgatatccatgatgcc
gatcagccccagcaactgagccaggtgggggcacccctgctggccagctacgatctcgag
gccctgaagaaggtttggcatccggccgctctgctaggacgtcctgccaccctgtggcgt
tatcacgagctgctgccggtgcgtgaccccgcccagtgggtgacactgggggaaggactg
acacccttgttgcccttgcgcgcactgggcaagcaggtcggcattccggatctctggatg
aaggatgagagcatcatccccaccggatccttcaaggcccgtggcgcagccgttggcatt
tcccgtgctcgtgaactcggtgtcacccattttgccatgcccaccaacggcaatgctgga
gccgcatgggctctttatggtgcccgtgcaggcctgcgcagcaccatagtcatgccacag
gaagccccggccattacccggttggagacatccctggcgggtgctcgcctttatctggtg
gatggcctgatcagcgatgcgggccgtcaagtcgctcaggctgtggtggatcaatccctg
tttgacgcctctaccctgaaggagccctatcggatcgagggcaagaagacaatggggctg
gagatcgccgaacagctgggttggaagttgccagatgtaatcatctaccccacaggcggc
ggggtcggcctcatcggcatctacaaggcgctccgtgagttgcaggaattgggctgggtc
aaaggggaccttccccggctggtggcggtgcaggccagtggttgcgcacccatagtgcag
gcttggcagcaaggggccagcgagtcgagcttctggccggactcccagaccctggccttc
ggcatcaatgtgcccaaggcgctgggagattttctggtgctcgatgcactctatcgtacc
aatggttgtgccatcgctgtggatgacagggcgattaaggcagagatccgccaactcgcg
tccctggaggggagctttgtctgcccggaaggggctgcggctttcgccgccgcccgccaa
ctgcgggagagtggctggatcaaggggggtgagcaggtagtggtgctcaatacgggggct
gggatcaagtacccggatgcaatcactgtgttgccccagcgactacgccgtgacgggagg
ataccggcatga

DBGET integrated database retrieval system