KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_0599Help
Entry
ASA_0599          CDS       T00500                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00260  Glycine, serine and threonine metabolism
asa00750  Vitamin B6 metabolism
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
asa01230  Biosynthesis of amino acids
Module
asa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASA_0599 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASA_0599 (thrC)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ASA_0599 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABO88765
UniProt: A4SIP3
Position
604357..605568
Genome map
AA seq 403 aa AA seqDB search
MPYSYLSHLRCSKTGDIHDADQPQQLSQVGAPLLASYDLEALKKVWHPAALLGRPATLWR
YHELLPVRDPAQWVTLGEGLTPLLPLRALGKQVGIPDLWMKDESIIPTGSFKARGAAVGI
SRARELGVTHFAMPTNGNAGAAWALYGARAGLRSTIVMPQEAPAITRLETSLAGARLYLV
DGLISDAGRQVAQAVVDQSLFDASTLKEPYRIEGKKTMGLEIAEQLGWKLPDVIIYPTGG
GVGLIGIYKALRELQELGWVKGDLPRLVAVQASGCAPIVQAWQQGASESSFWPDSQTLAF
GINVPKALGDFLVLDALYRTNGCAIAVDDRAIKAEIRQLASLEGSFVCPEGAAAFAAARQ
LRESGWIKGGEQVVVLNTGAGIKYPDAITVLPQRLRRDGRIPA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacagctacctatcacatctgcgttgcagcaagaccggcgatatccatgatgcc
gatcagccccagcaactgagccaggtgggggcacccctgctggccagctacgatctcgag
gccctgaagaaggtttggcatccggccgctctgctaggacgtcctgccaccctgtggcgt
tatcacgagctgctgccggtgcgtgaccccgcccagtgggtgacactgggggaaggactg
acacccttgttgcccttgcgcgcactgggcaagcaggtcggcattccggatctctggatg
aaggatgagagcatcatccccaccggatccttcaaggcccgtggcgcagccgttggcatt
tcccgtgctcgtgaactcggtgtcacccattttgccatgcccaccaacggcaatgctgga
gccgcatgggctctttatggtgcccgtgcaggcctgcgcagcaccatagtcatgccacag
gaagccccggccattacccggttggagacatccctggcgggtgctcgcctttatctggtg
gatggcctgatcagcgatgcgggccgtcaagtcgctcaggctgtggtggatcaatccctg
tttgacgcctctaccctgaaggagccctatcggatcgagggcaagaagacaatggggctg
gagatcgccgaacagctgggttggaagttgccagatgtaatcatctaccccacaggcggc
ggggtcggcctcatcggcatctacaaggcgctccgtgagttgcaggaattgggctgggtc
aaaggggaccttccccggctggtggcggtgcaggccagtggttgcgcacccatagtgcag
gcttggcagcaaggggccagcgagtcgagcttctggccggactcccagaccctggccttc
ggcatcaatgtgcccaaggcgctgggagattttctggtgctcgatgcactctatcgtacc
aatggttgtgccatcgctgtggatgacagggcgattaaggcagagatccgccaactcgcg
tccctggaggggagctttgtctgcccggaaggggctgcggctttcgccgccgcccgccaa
ctgcgggagagtggctggatcaaggggggtgagcaggtagtggtgctcaatacgggggct
gggatcaagtacccggatgcaatcactgtgttgccccagcgactacgccgtgacgggagg
ataccggcatga

DBGET integrated database retrieval system