KEGG   Aeromonas salmonicida: ASA_0644Help
Entry
ASA_0644          CDS       T00500                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
asa  Aeromonas salmonicida
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ASA_0644
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ASA_0644
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ASA_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661219..661752
Genome map
AA seq 177 aa AA seqDB search
MKWFTLLLLLGVGTASAACPDYFNVEQRELNSTQRHNLCQLTEGKVVLVVNTASYCGYRG
QFGDLETLYQTYKDKGLIVLGFPSNDFWQESGDEDKTAAVCRRDYGVTFPMFNRLAARGD
DASPLYKGLAAAAGEAPGWNFHKYLIGRDGKLIASYGANQNPADDPLQKEVKRALGL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttcactttgttattgctgcttggtgtcgggacggcctccgctgcctgccct
gattatttcaatgtggagcaacgggagctcaacagcacccagcgccacaacctctgccag
ctgaccgaaggcaaggtggtgctggtggtaaacacggcgtcttattgcggttatcgcggc
cagtttggggatctggagacgctttatcagacctacaaggacaaggggctgatagtgctg
ggttttccgtccaacgacttctggcaggagtcgggggatgaggacaaaactgccgctgtt
tgccgccgtgactacggggtgaccttccccatgttcaaccggctggcggcacgcggtgac
gatgcgagcccgctctacaaggggttggccgcggccgcgggcgaggcgccgggctggaac
tttcacaagtacctgatagggcgcgatggcaagctgatagcaagctatggtgcgaaccag
aatccggccgacgatcccctgcaaaaagaggtcaaacgggcgctcgggctttag

DBGET integrated database retrieval system