KEGG   Aeromonas salmonicida: ASA_0698Help
Entry
ASA_0698          CDS       T00500                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
asa  Aeromonas salmonicida
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(712629..713651)
Genome map
AA seq 340 aa AA seqDB search
MSKDSFAQSAAYLKQAVPLMIKYQIPTTPDNYTLWYNYVSASMPELNQAIDQAIKLQGTC
SLTTCERLYHQHLAAQDEQQMEAMKLSLAAMANELGHTMQDAISDTGMFQEMLDKSFDRL
SLIDDEGLSLDDTMGILRDLVRESRDVRMSTMHFRNQLSNAEKEIKELREALNETRKLAN
EDALTSLLNRRAFDLEIDGLIRSKQTFSLILSDIDRFKNFNDEYGHLLGDQVLRAFSKRL
RETCKEGVTAYRLGGEEFALLVPMRNLALSRQMAESLRRAIEKMSILDRKSGRRIDHITA
SFGVGEYNGQETGDALVERTDKLLYKAKELGRNRVMPLPS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggactcgttcgcgcaatccgccgcctatcttaagcaggcggttccactgatg
atcaagtatcaaattcccacgacgccggataactataccctttggtataactacgtgtcg
gccagcatgccagagctcaatcaggccatcgatcaggcgatcaagctgcagggcacctgc
tcactcaccacctgcgagcggctctatcatcagcacctcgccgcccaggatgagcagcag
atggaggccatgaaactcagtctggccgccatggccaacgagctcggccacaccatgcaa
gacgccatttccgacacaggcatgtttcaggagatgctcgacaagagcttcgatcgactg
agtctcatcgacgatgaagggcttagccttgacgacaccatgggcatcttgcgggatctg
gtgcgcgaatcgcgagatgtgcgcatgtcgaccatgcactttcgcaatcagctcagcaat
gcagagaaagagatcaaagagctgcgtgaggcactgaacgaaacccgcaagctggccaac
gaggatgccctcacctccctgctcaatcgccgcgccttcgatctggagatagacggcctg
atccgcagcaagcagaccttctccctcattctgtcggacatcgaccgcttcaagaatttc
aacgatgaatatggtcacctgcttggtgatcaggtgctgcgtgccttcagcaagcggctg
cgggaaacgtgcaaggagggcgtcaccgcctatcggctcggtggtgaggagttcgccctg
ctggtgcccatgcgcaacttggccctgagccgccagatggccgagagtctacgccgtgcc
atagagaagatgtccatcctggatcgcaagtccggccgccgcatcgaccacatcacagcc
tcgttcggagtgggtgagtacaatggtcaagaaacaggcgatgctctggtcgagcgcacc
gacaagctgctctacaaggcaaaagagctgggccgcaaccgggtcatgcccttgccgtcc
tga

DBGET integrated database retrieval system