KEGG   Aeromonas salmonicida: ASA_0698Help
Entry
ASA_0698          CDS       T00500                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
asa  Aeromonas salmonicida
Brite
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     ASA_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(712629..713651)
Genome map
AA seq 340 aa AA seqDB search
MSKDSFAQSAAYLKQAVPLMIKYQIPTTPDNYTLWYNYVSASMPELNQAIDQAIKLQGTC
SLTTCERLYHQHLAAQDEQQMEAMKLSLAAMANELGHTMQDAISDTGMFQEMLDKSFDRL
SLIDDEGLSLDDTMGILRDLVRESRDVRMSTMHFRNQLSNAEKEIKELREALNETRKLAN
EDALTSLLNRRAFDLEIDGLIRSKQTFSLILSDIDRFKNFNDEYGHLLGDQVLRAFSKRL
RETCKEGVTAYRLGGEEFALLVPMRNLALSRQMAESLRRAIEKMSILDRKSGRRIDHITA
SFGVGEYNGQETGDALVERTDKLLYKAKELGRNRVMPLPS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggactcgttcgcgcaatccgccgcctatcttaagcaggcggttccactgatg
atcaagtatcaaattcccacgacgccggataactataccctttggtataactacgtgtcg
gccagcatgccagagctcaatcaggccatcgatcaggcgatcaagctgcagggcacctgc
tcactcaccacctgcgagcggctctatcatcagcacctcgccgcccaggatgagcagcag
atggaggccatgaaactcagtctggccgccatggccaacgagctcggccacaccatgcaa
gacgccatttccgacacaggcatgtttcaggagatgctcgacaagagcttcgatcgactg
agtctcatcgacgatgaagggcttagccttgacgacaccatgggcatcttgcgggatctg
gtgcgcgaatcgcgagatgtgcgcatgtcgaccatgcactttcgcaatcagctcagcaat
gcagagaaagagatcaaagagctgcgtgaggcactgaacgaaacccgcaagctggccaac
gaggatgccctcacctccctgctcaatcgccgcgccttcgatctggagatagacggcctg
atccgcagcaagcagaccttctccctcattctgtcggacatcgaccgcttcaagaatttc
aacgatgaatatggtcacctgcttggtgatcaggtgctgcgtgccttcagcaagcggctg
cgggaaacgtgcaaggagggcgtcaccgcctatcggctcggtggtgaggagttcgccctg
ctggtgcccatgcgcaacttggccctgagccgccagatggccgagagtctacgccgtgcc
atagagaagatgtccatcctggatcgcaagtccggccgccgcatcgaccacatcacagcc
tcgttcggagtgggtgagtacaatggtcaagaaacaggcgatgctctggtcgagcgcacc
gacaagctgctctacaaggcaaaagagctgggccgcaaccgggtcatgcccttgccgtcc
tga

DBGET integrated database retrieval system