KEGG   Aeromonas salmonicida: ASA_0761Help
Entry
ASA_0761          CDS       T00500                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
asa  Aeromonas salmonicida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:asa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775113..777290
Genome map
AA seq 725 aa AA seqDB search
MLVERLVAARCADPFSHLGLQANPDGPGLKLTAWLPDALEVRVKDLKSGKVVATLAPTDE
SGLFETVFTRRKNPFPYQLLASYPDASTEFVDPYQFQDAGWAGLAELTSQPENIYHTLGA
QLRTVEHLGVRVEGVRFAVYAPSATAVSLIGDFNFWDGRRHPMQRSQCGHWVLFVPGLKA
GDRYKFELKDPAGHRLPHKSDPVGFYCEQYPSFASVVYDHDQYQWQDAAWIASQHNDKRD
QPLSIYELHVGSWKRHSNGDSLSWRELAVDLVAYIKEMEYTHIELLPVSEHPFSGSWGYQ
PVGMFSPTSRYGSADDFKYFVDQCHQAGIGVILDWVPAHFPSDAHGLARFDGTQLYEYED
PRRGWHPDWNSYIYDFGRNTVRQFLVASALFWLDKFHIDGLRVDAVASMLYLDYSRNAGE
WVPNVDGGNHNYEAISLLKWTNEEVYGKYPHAMTIAEESTAFAGVSRPTFLGGLGFGFKW
NMGWMHDTLTYMQKEPIHRRYHHNDMTFSMVYHYDENFILSLSHDEVVHGKHSMLYKMPG
DEWQQSANLRAYMGFMYAHPGKKLNFMGTEIAQSNEWNHDAQLPWHLLQYPKHGGQQRLI
RDLNHLYRHEAALYQADYEQTGFRWLDHNDADNSVFAWLRADKQGAHPIMVACNFTPVPR
IAYRLGVPAAGNYRVVLNTDSEHYWGSNYDVGLVFVAEPTPWQGLGHSIVLDLPPLATLF
IKQES
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttgaacgtttggttgctgcccgctgtgccgatcccttctctcatttaggcctg
caggccaatccggatgggcctggcctcaaactgaccgcctggttgccggatgcccttgag
gtgcgcgtcaaggatctcaagtcgggcaaagttgttgccactctggcacccaccgatgaa
tcgggcctttttgaaactgttttcacccgccgtaaaaatccctttccctatcagctgctt
gccagctaccccgatgccagtactgaatttgtcgacccctaccagtttcaggatgcgggt
tgggccggtctggcagaactgacctcccagccggaaaacatctaccacacgcttggcgca
caactgcgcaccgtggagcaccttggcgtgcgggtggagggggtgcgctttgccgtctat
gcgccgagcgccaccgctgtgagcctgatcggtgatttcaacttctgggacggccgtcgt
caccccatgcagcgcagccagtgcggtcactgggtgttgttcgtgccgggcctcaaggcc
ggggatcgctacaagtttgaactcaaggatcctgccggtcatcgtctgcctcacaagagt
gaccctgtcggtttctactgcgaacagtatccgtcgttcgcctcagtggtgtatgaccac
gatcaataccagtggcaagatgccgcctggattgccagccagcacaatgacaagcgggat
cagcccctctccatctatgaactgcatgtcggctcctggaagcgtcactccaacggcgac
agcctgagctggcgcgagctggcggtggatctggtggcctacatcaaggagatggagtac
acccatattgaattgctgccggtctccgagcatccgttcagcggttcctggggctatcag
ccggtgggcatgttctctcctaccagccgttacggcagtgccgatgacttcaaatatttc
gtggatcagtgccaccaggccggcataggcgtcatcctggactgggtgccggctcacttc
ccgtccgatgcccacggtctggcccgtttcgacggcacgcagctctatgagtacgaagat
ccgcgccgtggctggcacccggactggaactcctacatctacgactttggccgtaatacg
gtgcgccagttcctggtggcgagcgccctgttctggctcgacaagttccacatcgacggc
ctgcgggtggatgcggtcgcctccatgctctatctggattactcgcgcaatgccggcgag
tgggtgccaaacgtcgacggtggcaaccacaactacgaggcgatcagcctgctgaagtgg
accaacgaagaggtgtacggcaagtatccccacgccatgaccatagccgaagagtccacc
gcctttgccggagtgtctcgtcccactttcctcggtggcctcggttttggcttcaagtgg
aatatgggctggatgcacgacaccctcacttacatgcagaaagagcctattcaccgccgc
tatcaccacaacgacatgactttctccatggtttaccactatgacgagaacttcatcctg
tcgctctcccacgatgaggtggtgcacggcaagcactccatgctctacaagatgcccggc
gacgagtggcagcaatcggccaacttgcgcgcctacatgggcttcatgtatgcccacccg
ggcaagaagctcaacttcatgggcaccgaaatcgcccagagcaacgaatggaaccacgat
gcccagctgccctggcacctgctgcagtatcccaagcacggcggtcagcagcgcctgatc
cgcgatctcaaccacctctaccgtcatgaagctgccttgtatcaggccgattatgagcag
accggtttccgctggctggatcacaacgacgccgacaacagtgtctttgcctggctgcgg
gccgacaagcagggggcccacccgatcatggtggcctgcaacttcacgcctgtaccgcgc
atcgcctatcgactcggggtgcctgccgccggcaattaccgcgtggtgctcaacacggat
agcgagcattactggggcagcaactatgatgtgggtctggtcttcgtcgccgagccaacc
ccctggcagggattggggcacagcatagtgctggatctgccgccgctcgcgaccttgttc
atcaaacaggagtcttga

DBGET integrated database retrieval system