KEGG   Aeromonas salmonicida: ASA_0780Help
Entry
ASA_0780          CDS       T00500                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
asa  Aeromonas salmonicida
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(796880..797377)
Genome map
AA seq 165 aa AA seqDB search
MTEVFVAIGSNLADPLGQASRAVDALAALPESRLQQASSFYSSRPMGPADQPDYVNAVVR
LTTRLGPLALLDQLQRIELEQGRVRKDERWGPRTLDLDLLLYGDQIIGHERLVVPHYGMK
EREFVLLPLAEIAPALVLPCGTPLAELVARCPTNDLAIIAPGADV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtcttcgttgccatcggatccaatctggctgaccccctgggtcaggctagc
cgcgccgtcgacgcactggcggcgctgccggagtcccggttgcaacaggcttcctcgttt
tacagcagccgccccatgggccctgcggatcagccggactacgtcaatgccgtagtccgg
ctgacgacccggctaggccctttggccttgctggatcaattgcaaagaatcgagctggaa
cagggacgtgtgcgcaaggatgagcgttggggcccgagaaccctggatctggatctgctg
ctctatggcgatcagatcatagggcacgagcgcctcgtcgttcctcattacggcatgaag
gagcgggagttcgtgctgctgcccctggccgagattgcgcccgctctggtgctgccctgc
ggcaccccgctcgcggaactggttgcccgctgcccgaccaatgatcttgccatcattgcc
cccggtgcagacgtttag

DBGET integrated database retrieval system