KEGG   Aeromonas salmonicida: ASA_0818Help
Entry
ASA_0818          CDS       T00500                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asa  Aeromonas salmonicida
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ASA_0818 (galU)
   00052 Galactose metabolism
    ASA_0818 (galU)
   00500 Starch and sucrose metabolism
    ASA_0818 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ASA_0818 (galU)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ASA_0818 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(837356..838267)
Genome map
AA seq 303 aa AA seqDB search
MKKTQLVVRKAVLPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVREAIAAGIKEIILV
THSSKNSIENHFDKSFELEATLEKRVKRQLLEEVQHICPKDVTIMHVRQGEAKGLGHAIL
CARPLIGDNPFAVLLPDVLIDDMASNLKRDNLAEMVHMFEGDQISQIMVEAVPDSEVDKY
GIADIKGEALTEGMSLPMQAIVEKPPRDEAPSNLAVVGRYVLSANIWPLLERTPVGAGDE
IQLTDAIAMLMEHEQVNAYFMKGRSHDCGSKMGFMKANVEYAVRHPELNGEFTAWLKQFV
KQL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacacagctcgttgtacgcaaggccgttcttcctgtcgccggtttgggcacc
cgtatgctgcctgccaccaaggccatccccaaagagatgctgcccgtggtcgacaaaccg
ctgatccagtatgtggtgcgtgaagccatcgctgccggcatcaaggagatcatcctggtg
acccactcgagcaagaactccatcgagaaccacttcgacaagagcttcgaactagaagcc
accctggagaagcgggtcaagcggcagctgctggaggaggtgcaacacatctgccccaaa
gatgtcaccatcatgcatgtgcgccagggcgaggccaaaggtctgggccatgccatcttg
tgtgcccgcccgctgatcggcgacaaccccttcgccgtgctgctgccggacgtgctgatc
gatgacatggccagcaacctcaagcgcgataacctggcagaaatggtacacatgttcgaa
ggggatcagatcagccagatcatggtggaagcggttcccgacagcgaagtggacaagtac
ggtatcgccgatatcaagggcgaagccctgaccgagggcatgtccctgccaatgcaggcc
atcgtcgagaagccgccccgtgacgaggccccttccaatttggccgtggtcggccgctac
gtgctgtcagccaacatctggccactgctggagcgcacccctgtcggtgcaggtgacgag
atccaactgaccgacgccatcgccatgctgatggaacatgagcaggtcaacgcctacttc
atgaaaggacgcagccacgactgcggcagcaagatgggtttcatgaaagccaatgtggaa
tacgcggtacgccatccggaactgaacggtgaattcaccgcctggctgaagcagtttgtc
aaacagttgtaa

DBGET integrated database retrieval system