KEGG   Aeromonas salmonicida: ASA_0828Help
Entry
ASA_0828          CDS       T00500                                 

Gene name
tesA
Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
asa  Aeromonas salmonicida
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ASA_0828 (tesA)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ASA_0828 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ASA_0828 (tesA)
Lipid biosynthesis proteins [BR:asa01004]
 Fatty acid synthase
  Component type
   ASA_0828 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(856010..856681)
Genome map
AA seq 223 aa AA seqDB search
MVRLSWPRLTVLPRPLTTIMGVEFMTRFLFALCCLVSSVQAQTLMVLGDSLSAGYQMPAE
QSWPALLNQKWQQQGGEHQLINASISGETTQGALARLPALLKEHQPDWVLIELGGNDGLR
GFAPAITRDNLARMVALTKELQVKTVLTQIQLPRNYGARYLRQFEQIFPELAAANALPLM
PFFMDDIALRPELMMNDGIHPTAAAQPLIRDRVASFIEPLLTQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggctttcctggcccaggctaacggttttgcccaggcccttgacgacaataatg
ggagttgaattcatgacgcgtttcctgttcgccttatgttgcctggtttcatcggtacag
gcacaaaccctgatggtattgggtgacagcctgagtgcaggttatcagatgccggcggag
cagagctggcctgccctgctcaaccagaaatggcagcagcaagggggcgagcatcagctt
atcaatgccagcatcagtggtgaaacaacgcaaggggccctggcccgcctgcccgctctg
ctcaaggagcatcaaccggactgggtactgattgagctgggaggcaacgacggtttgcga
gggttcgcccccgccatcacccgtgacaatctggccaggatggtggcgttgaccaaggag
ctgcaggtcaagacagtgctgacccaaatccagctgccccgcaattacggggcccgctac
ctgcgccagttcgagcagatctttccggagctggccgccgccaatgcgctgccactgatg
cccttcttcatggatgatattgcgttgcgccctgaactcatgatgaacgatggcatccac
cccacggcggcggcccagccgctgatccgcgaccgtgtggccagctttatcgagcccctc
ttgacccaataa

DBGET integrated database retrieval system