KEGG   Aeromonas salmonicida: ASA_0837Help
Entry
ASA_0837          CDS       T00500                                 

Gene name
glsA
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
asa  Aeromonas salmonicida
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:asa00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:asa00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:asa00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
866706..867626
Genome map
AA seq 306 aa AA seqDB search
MVLSSELLASILAEVRPLLGQGKVADYIPALAQVPADRLGMAVCTVEGELFTAGDAFEPF
SIQSISKALSLTLALTLYQEEEIWARVGKEPSGQPFNSLVQLEFEQGIPRNPFINAGALV
VSDLLETRLTAPRQRTLELVRRLSGNPAIMADQVVARSEYQHSARNAAIAYLMKAYGNFE
NEVDKVLQSYFNACAIRMSCVDLARAFIYLANRGVPLGAGEPLLPARTTKQVNALLATCG
LYDEAGDFAYRVGMPGKSGVGGGIMALIPGELCVCVWSPELNKAGNSLAGTAALELLAER
LGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgtcatccgaattactggccagcattctggccgaggtgcgcccgctgctcggg
caaggcaaggtggccgactatattccggccctggcccaggtgccggccgatcggctcggc
atggcggtctgtaccgtggagggagagctgttcaccgccggtgacgccttcgagcccttc
tccatccagagtatctccaaggccctgagcctgacgctggcgctcaccctctatcaggag
gaggagatttgggcccgggtgggcaaggagccctccggccagccgttcaactcgctggtg
cagctggagttcgagcagggcataccacgcaacccctttatcaacgccggtgccctggtg
gtgagcgatctgcttgagacccggctcacggccccgcgccaacgtactctggagctggtg
cggcgcctcagtggcaacccggccatcatggcggatcaggtagtggcccgctccgaatat
cagcactccgcccgcaacgccgccatcgcctatctgatgaaggcttatggcaacttcgaa
aacgaagtggacaaggtgctgcaaagctacttcaatgcctgcgccatccgcatgagctgt
gtcgatctggcgcgggcattcatctatctggccaaccgcggcgtgccgctgggggccggt
gagccgctgctgccggcccgcaccaccaagcaggtcaatgccctgctcgccacctgtggt
ctctacgacgaggccggtgattttgcctatcgggtcggtatgccgggcaaatccggtgtc
ggagggggtatcatggcgctgatcccaggtgagctctgtgtgtgtgtctggtcgcccgag
ctcaacaaggctggcaactcgctggcgggcacggcggcactggagctgctggccgagcgt
ctgggccgttccattttttaa

DBGET integrated database retrieval system