KEGG   Aeromonas salmonicida: ASA_0837Help
Entry
ASA_0837          CDS       T00500                                 

Gene name
glsA
Definition
(GenBank) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
asa  Aeromonas salmonicida
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASA_0837 (glsA)
   00220 Arginine biosynthesis
    ASA_0837 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ASA_0837 (glsA)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ASA_0837 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
866706..867626
Genome map
AA seq 306 aa AA seqDB search
MVLSSELLASILAEVRPLLGQGKVADYIPALAQVPADRLGMAVCTVEGELFTAGDAFEPF
SIQSISKALSLTLALTLYQEEEIWARVGKEPSGQPFNSLVQLEFEQGIPRNPFINAGALV
VSDLLETRLTAPRQRTLELVRRLSGNPAIMADQVVARSEYQHSARNAAIAYLMKAYGNFE
NEVDKVLQSYFNACAIRMSCVDLARAFIYLANRGVPLGAGEPLLPARTTKQVNALLATCG
LYDEAGDFAYRVGMPGKSGVGGGIMALIPGELCVCVWSPELNKAGNSLAGTAALELLAER
LGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgtcatccgaattactggccagcattctggccgaggtgcgcccgctgctcggg
caaggcaaggtggccgactatattccggccctggcccaggtgccggccgatcggctcggc
atggcggtctgtaccgtggagggagagctgttcaccgccggtgacgccttcgagcccttc
tccatccagagtatctccaaggccctgagcctgacgctggcgctcaccctctatcaggag
gaggagatttgggcccgggtgggcaaggagccctccggccagccgttcaactcgctggtg
cagctggagttcgagcagggcataccacgcaacccctttatcaacgccggtgccctggtg
gtgagcgatctgcttgagacccggctcacggccccgcgccaacgtactctggagctggtg
cggcgcctcagtggcaacccggccatcatggcggatcaggtagtggcccgctccgaatat
cagcactccgcccgcaacgccgccatcgcctatctgatgaaggcttatggcaacttcgaa
aacgaagtggacaaggtgctgcaaagctacttcaatgcctgcgccatccgcatgagctgt
gtcgatctggcgcgggcattcatctatctggccaaccgcggcgtgccgctgggggccggt
gagccgctgctgccggcccgcaccaccaagcaggtcaatgccctgctcgccacctgtggt
ctctacgacgaggccggtgattttgcctatcgggtcggtatgccgggcaaatccggtgtc
ggagggggtatcatggcgctgatcccaggtgagctctgtgtgtgtgtctggtcgcccgag
ctcaacaaggctggcaactcgctggcgggcacggcggcactggagctgctggccgagcgt
ctgggccgttccattttttaa

DBGET integrated database retrieval system