KEGG   Aeromonas salmonicida: ASA_0903Help
Entry
ASA_0903          CDS       T00500                                 

Gene name
ccpA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
asa  Aeromonas salmonicida
Brite
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ASA_0903 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932624..933628
Genome map
AA seq 334 aa AA seqDB search
MHSYKGERKMNKYYLLLALGLPGMGWAVEPIQPVEAVKVGSPEKVELGKMLFFEPRLSKS
GAISCNSCHNLATGGVDNQVSSLGHKWKEGPINSPTVLNSSLNFVQFWDGRAKDLKAQAA
GPIENPLEMAFTHKLAVDTLHTLPEYRSRFSAVYGKADFGIDEVTDAIAAFEETLITPNA
PFDLWLKGDGKALTAHQLKGYQLFKEKGCTACHNGVAIGGNSYQKMGLVKQFKTDNPAQG
RGGVTGEKQFIGWFKVPTLRNIELTYPYFHDGSVWDLKEAVQIMADIQLGQALSEQDADD
MTAYLKSLTGEQPRIVLPILPPSQADTPRPQVKS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctacaagggagagagaaaaatgaataaatattatttgttgctggcgttgggc
ctgccggggatggggtgggcagtcgaaccgatccaacctgtcgaggcagtcaaggtggga
tcgccagagaaagtcgagctgggcaagatgttgttcttcgagccgaggctctccaaatcc
ggcgccatctcctgcaactcctgccataacctggcgaccggcggcgtggacaaccaggtc
agctccctcggtcacaagtggaaggagggaccgatcaactcccccacagtgctcaactcc
agcctcaacttcgtgcagttctgggatggccgcgccaaggatctgaaggcgcaggcggca
ggccccatcgaaaatccgcttgagatggccttcacccacaagctggcggtggataccctg
cataccctgcccgaatatcgtagccgtttcagcgccgtctacggcaaggcggactttggc
atcgatgaggtgacagacgccatcgccgccttcgaagagaccctgatcacccccaacgcg
ccgttcgatctctggttgaagggagacggcaaggcgctgacggcgcatcaattgaagggt
tatcagctgttcaaggagaagggctgcaccgcctgccacaacggggtggccatcggtggc
aactcctatcagaagatggggctggtcaagcagttcaagaccgacaacccggcccagggc
cgtggcggcgtgacgggcgagaagcagttcatcggctggttcaaggtgccgaccctgcgc
aatatcgagctgacctacccctacttccacgatggttcagtctgggatctgaaggaggcg
gtgcagataatggcggacatccagctgggccaggcgttgagcgagcaggacgctgacgac
atgaccgcctacctcaagagcctgaccggcgagcagccccggatagtgctgccgatcctg
ccgccctcccaagccgatacacccaggcctcaggtcaagagctga

DBGET integrated database retrieval system