KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1004Help
Entry
ASA_1004          CDS       T00500                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00010  Glycolysis / Gluconeogenesis
asa00051  Fructose and mannose metabolism
asa00562  Inositol phosphate metabolism
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
asa01200  Carbon metabolism
asa01230  Biosynthesis of amino acids
Module
asa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asa_M00002  Glycolysis, core module involving three-carbon compounds
asa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_1004 (tpiA)
   00051 Fructose and mannose metabolism
    ASA_1004 (tpiA)
   00562 Inositol phosphate metabolism
    ASA_1004 (tpiA)
Enzymes [BR:asa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ASA_1004 (tpiA)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ASA_1004 (tpiA)
  Exosomal proteins of bladder cancer cells
   ASA_1004 (tpiA)
  Exosomal proteins of melanoma cells
   ASA_1004 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABO89133
UniProt: A4SJR1
Position
1034695..1035459
Genome map
AA seq 254 aa AA seqDB search
MGHRKPFVAANWKLHGSRSQLEQFTDQCLQGIDEQVDVVLCPSHVHLDFTAALLNEQKVM
KLGAQNVSQHRQGAYTGEVSCEMLVEAGCRYVLVGHSERRRLFGETSFIVAEKFAAARAA
GLIPILCLAESGAARQARRAFEVIAEELDIVIEKNGAMAFDNAIIAYEPIWAVGTGKCAT
PEQAQEVHSFIRGRLAEDTPVIGEKVRIIYGGSVTPTNARDLFAQPDVDGGLIGGASLDD
KTFLGIVEAAKGAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggacatcgcaagccgtttgtagcagccaactggaagttacacggcagtaggtcgcag
ttagagcagtttactgaccaatgcctgcaaggtattgacgagcaagtagatgtggtcttg
tgtccatcccatgtgcatctcgacttcaccgccgcactgctcaacgagcaaaaggtaatg
aagttgggggctcagaatgtgagtcagcaccgacaaggcgcttatacgggtgaagtctcg
tgtgagatgcttgttgaggcagggtgtcgttacgtacttgtagggcactccgagcgcagg
cgtctctttggtgagaccagctttatcgtcgcagagaagtttgcggcagccagagcggca
ggcttgatccccatcctctgtttggctgagtcaggtgcagcgaggcaagcgagaagagcc
tttgaggtgatcgctgaagagctggatatcgtcatagagaaaaatggcgcgatggctttc
gataatgctatcatcgcctacgagccgatttgggctgtaggtacaggtaaatgcgccaca
cccgagcaggcacaagaggttcattcctttatacgcggtcgcttggcggaggatactcca
gtaataggtgagaaagttagaatcatctatggtgggagcgtgacaccgaccaatgcgaga
gatttgtttgcccagcccgacgttgacggcggcctgattggtggagcaagcctcgatgac
aagacgtttttaggaattgttgaagcggcaaagggtgcaagttaa

DBGET integrated database retrieval system