KEGG   Aeromonas salmonicida: ASA_1035Help
Entry
ASA_1035          CDS       T00500                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
asa  Aeromonas salmonicida
Brite
Enzymes [BR:asa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ASA_1035 (dsbC)
Secretion system [BR:asa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ASA_1035 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066938..1067672
Genome map
AA seq 244 aa AA seqDB search
MSKRVKHLLLGMMLLCTFAASAGMDPQLLKQRIEQRLGVQVYLVDATPMPGLFMLGTSQG
PLYADARGDYVLQGIMLDLGHDMKNLTMLGQRQRQQRQRALAQIGERRMQLKAEPERHSV
TLFTDLTCRNCRTALDELPILQAQGVSVQLLPALGTFADVAEVQARWCDPALFSELSLSD
RLPATGCNEILAHHIGLSQWLGIKALPSWVLPNGDLVRGYQSPEQLLKILDHINAPANPS
SSAS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaagagtgaagcatttactactgggaatgatgctgctgtgcacctttgctgcc
agcgcggggatggatccccaattattgaaacagcgtatagagcagcggctcggggttcag
gtctatctggtggatgcgacccccatgcccggtctcttcatgctgggcaccagtcagggg
ccgctctatgccgatgccaggggcgactatgtgctccagggcatcatgctggatctgggc
cacgacatgaaaaacctcaccatgctgggtcagcgtcagcgtcagcaacgtcagcgggcg
ctggctcagattggcgaacggcgtatgcagctcaaggccgagcccgagcgtcacagcgtc
accctgtttaccgatctgacctgccgcaactgccgtaccgcgctggatgagttgccaatt
ttgcaggcacagggggtgagtgtgcagttacttccggcgctgggtacctttgccgatgtg
gccgaggtgcaggcgcgttggtgcgatcccgctctgttcagtgaactcagtctcagtgat
cgtttgcctgcgaccggctgtaatgagatccttgcccatcatatcggcctgagccagtgg
ctcgggatcaaggcgctgccgagctgggtcctgccaaacggggatctggtgcggggttat
cagagccctgaacaactgctcaagatactggatcacatcaatgcccctgcaaatccgtcg
tcgtccgcgagttga

DBGET integrated database retrieval system