KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1172Help
Entry
ASA_1172          CDS       T00500                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00900  Terpenoid backbone biosynthesis
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASA_1172 (ispE)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ASA_1172 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABO89283
UniProt: A4SK61
Position
complement(1210722..1211591)
Genome map
AA seq 289 aa AA seqDB search
MATIRWPAPAKLNLFLNVNGRRPDGYHELQTLFIFLDHGDWLEFEPLPDTDQLTLSPAIP
GVPDEQNLIIRAARLLQARLPSPQGAHIRLEKLLPMGGGIGGGSSDAATTLVALNHLWQA
GLGEDELAELGVQLGADVPVFVRGRAAFAEGVGERLQPVELPGAWYLVLKPDCHVATAAV
FQDPDLPRATPKMAFHNLLEGEWKNDCELLVKKRYPEVANALGWLLEYAPSRMTGTGACV
FAQFEDEKAAREVLAKVPKRWDGFVAKGENISPLFVTLQQISDWDIAKR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccaccattcgctggccggcaccggccaaactcaaccttttcctgaatgtcaatggc
cgtcgtccggacggctatcacgagctgcagaccctgttcatctttctggatcacggcgac
tggctcgaattcgagccactgccggacacggaccagctcaccttgagcccggccattccc
ggcgtgcccgatgagcagaacctcatcatccgcgccgcccgcctgctgcaggcgcggttg
cccagcccgcagggggcccatatccggctggagaagctgctgcccatgggcggtggtatc
ggcggtggatcctcggatgcagccaccacgctcgtggcgctcaatcacctctggcaggca
ggcttgggcgaagatgaactggcagaacttggcgttcagctgggggccgatgtgccggtg
tttgtgcgcggacgcgccgcctttgcagaaggggtgggcgagcggctgcaaccggtcgaa
ttgccgggtgcctggtatctggtgctcaagcccgattgccacgtggcaacggccgccgta
ttccaggatccggacctgcccagagcgaccccgaaaatggcatttcacaacttgctggag
ggggagtggaaaaacgattgcgaattgctggtgaaaaagcgctaccccgaggttgccaat
gcgctcggctggttgctagaatacgcgccgtcaagaatgacgggcacaggagcctgcgtc
tttgctcaatttgaagacgaaaaggctgctcgggaagtgttggcaaaggtgccgaaaaga
tgggatgggtttgtcgccaagggcgagaacatatcaccactattcgtgacattgcaacaa
atcagtgattgggatatcgccaagcggtaa

DBGET integrated database retrieval system