KEGG   Aeromonas salmonicida: ASA_1323Help
Entry
ASA_1323          CDS       T00500                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
asa  Aeromonas salmonicida
Pathway
asa00010  Glycolysis / Gluconeogenesis
asa00052  Galactose metabolism
asa00500  Starch and sucrose metabolism
asa00520  Amino sugar and nucleotide sugar metabolism
asa00521  Streptomycin biosynthesis
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
asa01200  Carbon metabolism
Module
asa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_1323 (glk)
   00052 Galactose metabolism
    ASA_1323 (glk)
   00500 Starch and sucrose metabolism
    ASA_1323 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ASA_1323 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ASA_1323 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ASA_1323 (glk)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ASA_1323 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABO89425
UniProt: A4SKK3
Position
1380429..1381397
Genome map
AA seq 322 aa AA seqDB search
MQHTHALVGDVGGTNARLALCELATGTISRAKTYSGLAHPSLEAVVRLYLDEHAAQVSQA
CIAIACPINGDWVAMTNHSWEFSIGEMQANLGLTRLQVINDFTAVSMAVPVLAEADRIQL
GGGAPVADKPIAIYGAGTGLGVAHLVQAGEQWLSLPGEGGHVDFSANSEEEDAVLQVMRA
ELGHVSAERLLSGPGLVNIYRGLVKSDGREPEALAPKDITERALAGDCLDCRRTLSLFCV
LMGRFAGNLALNMGTFGGVYIAGGIVPRFQEFFIGSGFRVAFEDKGRFKSYLKDIPVFLI
THEGPGLLGAGAYLRQSLGIKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatacccatgcgctggtcggtgacgtcggtggcaccaatgcacggctggccctg
tgcgagctggcgaccggcaccatttcccgggccaagacctattccgggctggcccatccc
agcctcgaagccgtggtgcgcctctatctggacgaacacgctgcgcaggtgagccaggct
tgcatcgccatcgcctgccccatcaacggtgactgggtcgccatgaccaaccacagctgg
gagttttccatcggcgagatgcaggccaatctgggcctgacccgcttgcaggtgatcaat
gactttaccgccgtctcaatggcggtgcccgtgctggcagaagccgatcgcatccagctg
gggggcggggcccctgtggcggacaaacccatcgccatttatggggcggggaccggcctt
ggtgtcgcccatctggtgcaggcgggtgagcaatggctgagcctgccgggcgaaggcggt
cacgtggatttttccgccaacagcgaagaagaggatgcagtgctgcaggtcatgcgcgcc
gagcttggtcatgtctcggccgagcggctgctctccggccctggtctggtgaacatctat
cgcggtctggtgaagtccgatgggcgcgagccagaggcattggcccccaaagacatcact
gagcgggcgctggcgggggattgcctggattgtcgccgcaccttgagcctgttctgtgtg
ctgatgggtcgctttgccggcaacctggcgctcaacatgggcaccttcggcggcgtctat
atcgcaggcggcatcgtaccgcgttttcaggagttctttattggctcgggctttcgggtg
gcgtttgaagacaaggggcgtttcaaatcctatctgaaggatatccccgtcttcctcatt
actcacgaggggccgggtctgctcggtgccggtgcctatctgcgccagtcgctcggtatc
aagttgtaa

DBGET integrated database retrieval system