KEGG   Aeromonas salmonicida: ASA_1402Help
Entry
ASA_1402          CDS       T00500                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
asa  Aeromonas salmonicida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASA_1402 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASA_1402 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASA_1402 (trpA)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ASA_1402 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1459195..1460001)
Genome map
AA seq 268 aa AA seqDB search
MNPYAQLFSRLDAVNQGAFVPFVMLGDPTPELSLAIVDALVAGGADALELGIPFSDPVAD
GPTIQGAALRAFESHTTPDDCFELLGRIRAKYPQLPIGLLVYANLVYVRHIDGFYEKCQQ
AGVDSVLVADVPVQMCAPYKAAADKFGIDSIFIAPPNGDAETLKQVAELGSGYTYLVSRA
GVTGAETKAGMPVDGLINTLREFNAPPALLGFGISEPAQVREAIAAGAAGAISGSAVVKI
IETHHQNPEHMLTRLKEFVEGMKAATNR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttacgcacaactcttctcccgtctggatgcggtcaatcagggcgcctttgta
ccattcgtgatgctgggtgaccccaccccagaactctccctggccatcgttgatgcgctg
gtcgcagggggcgccgatgccctcgagctcggcattcccttctccgatccggtagcggat
ggccccaccattcagggtgccgccctgcgcgccttcgagagccacacaaccccggacgac
tgcttcgagctgctcggccgcatccgcgccaagtacccgcagctgcccattggcctcttg
gtctacgccaacctggtttatgtgcgccacatcgacggcttctatgagaagtgccagcag
gcgggtgtggattctgtgctggtcgccgacgtgccggtgcagatgtgcgccccctacaag
gcggccgccgacaagttcggcatcgacagcatctttatcgccccgcccaatggcgatgcc
gagaccctgaaacaggtggcggagctgggcagtggttacacctatctggtgagccgcgcc
ggtgtgaccggcgccgagaccaaggccggcatgccggtagatggcctgatcaataccctg
cgcgagttcaatgccccccccgccctgctcggctttggtatcagcgaaccggctcaggta
cgtgaagccattgccgcaggcgcggccggtgccatctccggctccgccgtggtgaagatt
atcgagacacaccaccagaacccggagcatatgctcactcgtctgaaggagtttgtggaa
gggatgaaggcggcgaccaatcgataa

DBGET integrated database retrieval system