KEGG   Aeromonas salmonicida: ASA_1403Help
Entry
ASA_1403          CDS       T00500                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
asa  Aeromonas salmonicida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASA_1403 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASA_1403 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASA_1403 (trpB)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ASA_1403 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1459998..1461191)
Genome map
AA seq 397 aa AA seqDB search
MTLLNPFFGEFGGMYVPQILIPALLQLEKAFVDAQEDPAFIAEFQELLTEYAGRPTPLTL
TRNLTKGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDCERQKPNVFRMKLMGATVIPVHSGSSTLKDACNEALRDWAASY
DNAHYLLGTAAGPHPFPTIVREFQKMIGEEAKAQCFKKEERLPDAVIACVGGGSNAIGMF
ADFIDNKEVRLIGVEPGGHGIESGEHGAPLGHGSKGVFFGMHSYLMQDKQGQIQESYSVS
AGLDFPSVGPQHAHLASIGRAEYVSITDKEALDAFQELAKSEGIIPALESSHALAHALKM
ARSEPEKELVLIVNLSGRGDKDIFTVADIFEKEGTLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctcaacccgttttttggtgaatttggcggcatgtacgtgccccaaatcctc
atccccgccctgcttcagctggaaaaagccttcgtcgatgctcaggaagatccggccttt
atcgccgaatttcaggagctgctgaccgagtatgccggtcgcccgaccccgctcaccctg
acccgcaacctgaccaagggcaccaagacccgcctctatctgaagcgcgaagacttgctg
cacggcggcgcccacaagaccaaccaggtgctgggtcaggcgctgctggccaagcgaatg
ggcaaaaccgagatcatcgccgagaccggcgccggtcaacacggcgtcgccaccgcactg
gcctgcgccctgctcggcctcaagtgccgggtctatatgggcgccaaggattgcgagcgc
cagaagcccaacgtctttcgcatgaagctgatgggtgccaccgtcattccggtgcattcc
ggctcatccaccctcaaagatgcctgcaacgaggcgctgcgtgactgggctgccagctac
gacaacgcccactacctgctgggaacggccgccggtccgcaccccttccccactatcgtg
cgggagttccagaaaatgatcggcgaagaggccaaggcccagtgcttcaagaaagaggag
cgcctgcccgatgcggtgatcgcttgtgtcggcggcggctccaacgccatcggcatgttt
gccgactttatcgacaacaaggaggtgcgtctgatcggggtcgagccgggtggtcacggc
atcgagagtggcgagcacggtgcgccgctgggtcacggcagcaagggggtcttctttggc
atgcactcctacctgatgcaggacaagcaggggcaaattcaggagtcctactccgtctcg
gcggggctggatttcccctccgtcggcccgcagcacgcccatctggcttccatcggccgc
gccgagtatgtctccatcaccgacaaggaggcgctggacgccttccaggagctagccaaa
tccgaggggattatcccggcgctggagtcctcccacgcgctggctcacgccctcaagatg
gcccgcagtgaaccggaaaaagagctggtgctgatcgtcaacctctccggccgtggcgac
aaagatatcttcaccgtggcagacatttttgaaaaagaaggaaccttgtcatga

DBGET integrated database retrieval system