KEGG   Aeromonas salmonicida: ASA_1425Help
Entry
ASA_1425          CDS       T00500                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
asa  Aeromonas salmonicida
Pathway
asa00521  Streptomycin biosynthesis
asa00523  Polyketide sugar unit biosynthesis
asa01130  Biosynthesis of antibiotics
Module
asa_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ASA_1425 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ASA_1425 (rfbC)
Enzymes [BR:asa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ASA_1425 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABO89524
UniProt: A4SKV2
Position
1485448..1485999
Genome map
AA seq 183 aa AA seqDB search
MNVINTSIPEVLIFEPQVFGDERGFFFESFNYQQFEEAVGHQVKFIQDNHSRSSQGVLRG
LHYQLPPHAQGKLVRCIVGEVFDVAVDIRETSPNFGQWVGVNLSAENKRQLWIPEGFAHG
FLTLSTAAEILYKTTNYYQPSHERSIIWNDNVLAIKWPFDKNIILSKKDSLAPHFIDFLK
KGE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgatcaatacttcgatacctgaagttcttatttttgagccccaagtgtttggt
gacgaacgtggttttttctttgaaagttttaactatcagcaatttgaagaagctgttggt
catcaagtaaaatttatacaagataatcattctagatctagccaaggggtacttcgtggt
cttcattaccagctacctccacatgctcaaggtaaattagtccgctgtatcgttggtgag
gtttttgatgtggccgtcgatattcgtgaaacatcacctaattttggtcagtgggttggc
gttaatctatcagcagaaaataaacgtcagctatggatccctgaaggatttgcacatggc
tttttgacactaagcactgctgctgaaattttatataaaactactaactattatcagcca
agccatgagcgatccataatatggaacgataatgttttagccattaaatggccctttgac
aaaaatattatactatctaaaaaagatagtctggcaccccattttattgattttttaaaa
aagggggagtga

DBGET integrated database retrieval system