KEGG   Aeromonas salmonicida: ASA_1515Help
Entry
ASA_1515          CDS       T00500                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
asa  Aeromonas salmonicida
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASA_1515 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASA_1515 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ASA_1515 (aceB)
Enzymes [BR:asa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ASA_1515 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1584619..1586226)
Genome map
AA seq 535 aa AA seqDB search
MSAPAQTHCSARLRIQGEMLPEYAQILTPDAVALVSELVERFAPQRGELLKQRVARQARI
DGGELPDFLPETAHIRAGDWTVRGIPADLQDRRVEITGPVERKMVINALNANVEVFMADF
EDSLAPAWNKVIEGQINLRDAVNGTVSYTSPEGKAYTLNSNPAVLICRVRGLHLPEKHVT
FDGEPIPGGLFDFALYFLHNHQALLAKGSGPYFYVPKLQSHLEGRWWSEVFAWTEDKFGL
PRGTIKATVLIETLPAVFEMDELLYQMQDHIVALNCGRWDYIFSYIKTLKDHGDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAAVNEQVFAKVKADKEREAS
NGHDGTWVAHPGLADTAMAVFNATIPAGAKNQIGVLREQDAPITAADLLAPCEGERTETG
MRTNIRVALQYLEAWIGGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKSLSNGKVVTKE
LFRQMLAEEQEVVKHEVGAARWQAGRFAEASELMEQITCADTLIDFLTLPGYERL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaccggcccagacccactgtagcgcccgtctgcgcatccagggcgagatgctt
cccgaatacgcgcaaattctgacgccggatgcggtggccctggtatccgaactggtggaa
cgctttgctccccaacggggcgaattgttgaaacaacgtgtggcacgccaggcccgtatc
gatggcggcgagctgccggactttctgccggaaacagcacatatccgtgcaggcgactgg
acggtgcgcggtatcccggccgacttgcaagaccgccgggtagagataacggggccagtt
gagcgcaagatggtcatcaacgctctcaacgccaatgtcgaagtcttcatggcggacttc
gaggattccctggctcctgcctggaataaagtgatcgagggtcaaatcaacctgcgcgat
gcggtcaatggcaccgtctcctacaccagtccggaaggcaaagcctataccctgaattcc
aatccggccgtgctcatctgccgggtacgtggcctgcacctgccggaaaaacatgtcacc
ttcgatggggagcccatccccggcggcctgttcgacttcgcactctatttcctgcacaac
catcaggcgctgctggccaagggctcgggcccctacttctatgtgcccaagctgcaaagt
catctggaaggtcgctggtggagcgaagtgtttgcctggaccgaagacaagttcggtctg
ccccgcggcaccatcaaggctaccgtgctgatcgaaaccctgccggcggtgttcgagatg
gatgagctgctctatcagatgcaggatcacatagtcgcgctgaactgcggccgctgggac
tacatcttcagctatatcaagacgctgaaagatcatggggacagagtgctgcccgaccgt
caggtggtcaccatggacaaacccttcctctcagcctattcacggctgctgatcaagacc
tgccacaagcggggcgctcttgccatgggcggcatggccgcctttatcccggccaaggat
gccgccgtcaacgagcaggtgtttgccaaggtcaaggcggacaaggagcgggaagcaagc
aacggccacgatggcacctgggtcgcccatcccggcctcgccgacaccgccatggccgtg
ttcaacgccaccataccggcaggcgccaagaaccagatcggcgtattgcgcgagcaggat
gcacccatcacagccgccgacctgctggctccctgtgaaggcgaacgtaccgaaacgggc
atgcgcaccaatatccgggtcgccctgcaatatctggaagcctggataggtggcaatggc
tgcgtgcccatctatggcctgatggaagatgcggccaccgccgagatctcccgcacctcc
atctggcagtggatccgccacggcaagagcctctccaacggcaaggtggtgaccaaagag
ctgtttcgccagatgctggccgaggagcaggaggtggtcaaacatgaagtgggcgccgcc
cgctggcaagcaggacgctttgccgaagcgagcgagttgatggagcagatcacctgcgcc
gataccctgatcgattttctgacgctgcccggttacgagcggctctga

DBGET integrated database retrieval system