KEGG   Aeromonas salmonicida: ASA_1538Help
Entry
ASA_1538          CDS       T00500                                 

Gene name
phoA2
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
asa  Aeromonas salmonicida
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ASA_1538 (phoA2)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ASA_1538 (phoA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ASA_1538 (phoA2)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ASA_1538 (phoA2)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASA_1538 (phoA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610192..1611583)
Genome map
AA seq 463 aa AA seqDB search
MSKQMNTSIKHTLVCAALFSALGATTQAQAGDAKNVILFIGDGMGPTVLTATRLFKVGEE
GNLEMMKLPRSARIKTFSNDAQTTDSAPSMAAYTTGVKMNNEVIAMSSDTQAVAPGKDAN
GNKGINNCTADNGKPAPTILELAKAAGKSVGAVTTTELTHATPAATYSHICHRDAAYAIA
EQAVPGGAGFNTALGDGVDVLMGGGANHWTPYSASNKGGRADGRDLTAELTAQGYNYVTT
QSELAKVSSGKVLGLFSTKSHLDYELDRVAKGDANTQPSLAEMTAKAIDLLSQNSQGYFL
MVEGGRIDHALHGTNAKRALTDAVALDEALKMALGKVDLKDTLVVVTADHDHTMTINGYS
AKGNPVLDLVKNGDGSTQNDVDGKPFTTLVFGNGPNRPDVRPTLTSDEVMDNDYLQETGV
KLGSETHGGGDVMLFADGAGSNRFKGTLDNTKVFGKLREALGL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacagatgaatacatccatcaagcacacgctggtctgcgcggccctgttcagt
gcgctgggcgcaaccacccaggcccaggccggtgacgccaaaaacgtcattctctttatc
ggtgatggcatgggccccactgtgctcaccgccactcgtctgttcaaggtgggcgaagag
ggcaacctggagatgatgaagctgccacgcagcgcccgcatcaagaccttctccaacgat
gcccagaccacggattcggccccctccatggcggcctataccacgggcgtcaagatgaac
aacgaggtgatcgccatgagcagcgacacccaggccgtggcgcccggcaaggatgccaac
ggcaacaagggcatcaacaactgcaccgccgacaacggcaagccggcgcccaccatactg
gagctggcaaaggcggccggcaagtcggttggcgccgtcaccaccaccgagctgacccat
gccaccccggcggccacctattcccacatctgccacagagatgcggcctatgccatcgcc
gaacaggcggtgccgggcggagccggtttcaacaccgccctcggggatggggtcgatgtg
ctgatggggggcggtgccaatcactggaccccttacagcgccagcaataaaggtggccgc
gccgatggtcgggatctcaccgccgagctgaccgctcagggatacaactatgtcaccacc
caaagcgagctggccaaggtcagcagcggcaaggtgctgggtctgttcagcaccaaatcc
cacctcgactacgagctggaccgcgtcgccaagggggatgccaatacccagccgtccctg
gccgaaatgaccgccaaggcgatcgatctcttgagccagaacagtcagggttacttcctg
atggtagaagggggccgtatcgatcacgccctgcatggcaccaacgccaagcgtgccctc
accgatgcggtggcactggatgaagcgctcaagatggcgctgggcaaggtggatctgaaa
gatacgctggtcgtagtgactgccgaccatgatcacaccatgaccatcaacggctactcc
gccaagggcaaccctgtgctggatctggtcaagaacggtgatggctcgacccagaacgac
gtggatggcaaacccttcacgaccctggtgtttggcaacggccccaaccgccccgatgtg
cgcccgaccctcaccagcgacgaggtgatggataacgactacctgcaggagacaggcgtc
aagctgggctccgagacccacggtggcggtgacgtcatgctgttcgccgatggtgccggc
agcaatcgcttcaagggcaccctggacaataccaaggtgttcggcaaactgcgggaggcg
ctcggcctgtaa

DBGET integrated database retrieval system