KEGG   Aeromonas salmonicida: ASA_2232Help
Entry
ASA_2232          CDS       T00500                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asa  Aeromonas salmonicida
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASA_2232 (tpiA)
   01230 Biosynthesis of amino acids
    ASA_2232 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_2232 (tpiA)
   00051 Fructose and mannose metabolism
    ASA_2232 (tpiA)
   00562 Inositol phosphate metabolism
    ASA_2232 (tpiA)
Enzymes [BR:asa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ASA_2232 (tpiA)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ASA_2232 (tpiA)
  Exosomal proteins of bladder cancer cells
   ASA_2232 (tpiA)
  Exosomal proteins of melanoma cells
   ASA_2232 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2366120..2366875
Genome map
AA seq 251 aa AA seqDB search
MRQHLVMGNWKLNGTKASVEALIKGLTPAAAAHPSVQVAVCPPVIFLGLVEQLTAGSKIA
YGAQNADVHESGAFTGENAPSMLKAFGCTYSLVGHSERRTLHAENDDVVAAKYEAIQKAG
LIPVLCIGETLEQFEAGVTKTVVETQLKAVIDRCGIASFSNAVVAYEPVWAIGTGKTATP
EIAQSVHAHIRQYLAGFDGAVAAKVQILYGGSVTGATAADLFGQPDIDGGLVGGASLKVD
DFSQIIAGAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcacctggtaatgggtaactggaaactgaacggcaccaaagcttctgtagaa
gctctgatcaaaggactgaccccggctgctgccgctcatccttccgtacaagtcgccgtc
tgcccgccggttatctttttgggtctggttgagcagctgaccgcaggcagcaagattgcc
tacggtgcccagaatgccgacgttcacgagtccggcgccttcaccggcgagaacgccccc
tccatgctcaaagccttcggttgcacctactccctggtcggtcacagcgagcgccgtacc
ctgcacgcagagaacgacgacgtggtagccgccaagtacgaagccatccagaaagcgggc
ctgatccccgtattgtgcatcggtgagaccctggagcagttcgaagccggcgtgaccaag
actgtggttgagacccagctgaaagccgtcatcgaccgttgcggcatcgcctccttcagc
aacgccgtggttgcctatgagccggtatgggccatcggtaccggcaagactgctaccccg
gaaatcgctcaatccgttcacgctcacatccgtcagtacctggccggttttgatggcgcc
gtggctgccaaagtacagatcctgtacggcggctccgtcactggtgcaaccgctgccgac
ctgttcggtcagccggacatcgacggtggcctggtgggtggtgcgtccctgaaagtggac
gacttctcccagatcatcgctggcgcagccaagtaa

DBGET integrated database retrieval system