KEGG   Aeromonas salmonicida: ASA_2233Help
Entry
ASA_2233          CDS       T00500                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asa  Aeromonas salmonicida
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASA_2233 (pfkA)
   01230 Biosynthesis of amino acids
    ASA_2233 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_2233 (pfkA)
   00030 Pentose phosphate pathway
    ASA_2233 (pfkA)
   00051 Fructose and mannose metabolism
    ASA_2233 (pfkA)
   00052 Galactose metabolism
    ASA_2233 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ASA_2233 (pfkA)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ASA_2233 (pfkA)
Protein phosphatases and associated proteins [BR:asa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ASA_2233 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2367023..2367994
Genome map
AA seq 323 aa AA seqDB search
MTKQLKRIGVLTSGGDAPGMNAAIRAVVRAGLHHGLEVYGIYDGYLGLHQDRIVKLERHS
VSDVVNRGGTFLGSARFPAFKDPAVRAEAIENLKKHGIDALVVIGGDGSYMGAKKLTEEG
FPCIGLPGTIDNDIAGTDFTIGFDTALNVVVDAIDRLRDTCSSHHRISVVEIMGRHCGDL
AMSAAVAGGAEYVIVPEVAFDKEKLLQQIKEGEAKGKKHAIITICEHVTDVNALAKDIEA
MTGRETRATILGHIQRGGSPTARDRIMSSRMGAFAVEQLLAGQGGRCVGIQGNEMVHHDI
IDCIENLKRPFDQELYDLSTTLF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaactcaaacgtattggtgttttgaccagtggtggtgacgcaccgggtatg
aacgcagccattcgcgccgtggtgcgcgccggtctgcatcatggcctggaagtttatggc
atctatgatggctaccttggtctgcatcaggacaggatcgtcaagctggagcgtcacagc
gtctccgacgtggtgaaccgtggcggtaccttcctgggttctgcccgtttccccgccttc
aaagatccggccgtgcgtgccgaagcgatcgaaaacctgaaaaagcacggcatcgatgcc
ctggtggtgatcggcggtgacggctcctacatgggtgccaagaagctgaccgaagagggt
ttcccctgcatcggcctgccgggcaccatcgacaacgacatcgccggtaccgacttcacc
atcggctttgataccgccctgaacgtggtggttgacgccatcgaccgtctgcgcgacacc
tgcagctcccaccaccgtatttcagtggtcgagatcatgggtcgccactgcggcgatctg
gccatgtctgccgccgttgctggcggtgccgagtacgtgatagtaccggaagtggccttt
gacaaagagaagctgctgcaacagatcaaggaaggcgaagccaaaggcaaaaaacacgcc
atcatcacaatctgtgaacacgtcaccgacgtgaatgcgctggccaaggacatcgaagcc
atgactggccgcgaaacccgcgccaccatactgggtcatatccagcgtggcggctcaccg
actgcacgcgatcgcatcatgtccagccgcatgggtgccttcgccgtcgaacagctgctg
gcgggccagggtggccgctgcgtcgggatccagggcaacgagatggtgcaccacgacatc
atcgactgcatcgagaacctgaagcgcccgttcgatcaggagctgtacgatctctccacc
acactgttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system