KEGG   Aeromonas salmonicida: ASA_2860Help
Entry
ASA_2860          CDS       T00500                                 

Definition
alcohol dehydrogenase IV
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
asa  Aeromonas salmonicida
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ASA_2860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_2860
  Lipid metabolism
   00071 Fatty acid degradation
    ASA_2860
  Amino acid metabolism
   00350 Tyrosine metabolism
    ASA_2860
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASA_2860
   00626 Naphthalene degradation
    ASA_2860
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ASA_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3080291..3081484
Genome map
AA seq 397 aa AA seqDB search
MNNMSRYYDFFCPVKLIAGEQALEQLAGELAGLGARRPLLLTDKGVSGTGLATLLANVLA
EGELPVADIWDEIPADSSTAVVERIAARYRELECDSLVALGGGSVIDTAKAVNILASMGG
DRLLDYAGAGCLTRPLQPLAVVPTTAGTGSEVTLVAVIKDEASGRKVPFTSPFLLPQLAV
LDPRLTQGLPLNITAATAMDAMTHAIEAFIGNAKNPVSDALALMAIEKIANALPKVLQSP
QDKQLRLQLAEGSTLAGMAFSNSMVGLVHALGHSLGARCHLPHGLCMNLFLPTVLDYNRP
GIDPELARLLLPLVGAERFAATPATEQAQASIQALCALRDSLWQAVKLPRTLREAGVTDK
GLLPEIRDLAINDGALLYNRKDADRAQLLDLLERAWE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatgagtcgctattacgatttcttctgtccggtcaaactgatagcgggcgag
caggcgctggaacagctggctggcgaattggcgggtctgggggcacgccgtccgctgctg
ctcactgacaagggggtcagcggcacagggctcgccaccctgctggccaatgtgctggcc
gagggggagctgccggtcgccgacatctgggacgagatcccggccgactcctccaccgcc
gtggtggagcggatcgcggcccgctatcgggagctcgaatgcgacagcctggtggcgctg
ggcggcggctccgtcatcgacaccgccaaggcggtcaacatcctcgcctccatgggcggg
gatcggctgctggattacgccggagcaggctgtctgacccggcccctgcagccactggcg
gtggtgcccaccacggcaggtacgggatccgaggtgacgctggtggcggtgatcaaggat
gaggcgagcgggcgcaaagtgcccttcacctcccccttcctgctgccccagctggcggtg
ctggatccgcgcctcactcagggcttgcccctcaacatcacggccgccaccgccatggat
gccatgacccacgccatcgaggccttcatcggcaatgccaagaatccggtcagcgacgcc
ctggccctgatggcgatagagaaaattgccaacgccttgcccaaggtgctgcaaagcccg
caagacaagcagctgcggctgcaactggcggaaggatccaccctggcggggatggcgttt
tccaactccatggtggggttggtgcatgccctcggccacagcctgggggcccgctgtcac
ctgccccacggtctgtgcatgaacctcttcctgccgaccgtgctcgactacaaccgcccg
ggcatagaccctgagctggcccgcctgctgctgcccctggtcggtgccgagcgctttgcg
gcaaccccggccacagaacaggcacaagcaagcattcaggcactgtgcgccctgcgcgat
agcctgtggcaggcggtgaagctgccgcgcaccttgcgtgaagcgggcgtcaccgacaag
gggttgctgcccgagatccgggatctcgccatcaatgacggcgccctgctctataaccgc
aaggatgccgaccgggctcaactgctcgacctgctggaacgggcgtgggagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system