KEGG   Aeromonas salmonicida: ASA_3038Help
Entry
ASA_3038          CDS       T00500                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
asa  Aeromonas salmonicida
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASA_3038 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASA_3038 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASA_3038 (thrC)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ASA_3038 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3272235..3273509)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKDKSEQVSFAQAVRQGLGRDQGLFFPEVIAPLADVDALLDLPLAERSARIINHL
LGDEVPAAKVSGLINAAFTFPSPLVKLKDGTYALELFHGPTLAFKDFGGRFMAQCLATFR
TNDKITILTATSGDTGAAVAHAFYGLEGIEVVILYPKGKISPLQEKLFCTLGGNIRTIAI
DGDFDACQALVKDAFDDEALKKAIGLNSANSINISRLLAQVCYYFEAVAQLPKADRAKAV
ISVPSGNFGNLTAGLIAKALGLPVKRFIAATNANDTVPRYLKSGQWEPHQTVATLSNAMD
VSRPNNWPRVEELCRREGWALETLGSGMRDEAQTRDALKRLHQLDYLCEPHGAIAWDLLG
EQLAEDEVGVFLCTAHPAKFKESVDEILSLDVPLPGPLAKHAELPLLSVNLPAEFARLRA
FLVG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttacaatatcaaggacaagagtgaacaggtgagcttcgcgcaggcggtgcgt
caggggctgggtcgcgatcaggggctcttcttccccgaggtgattgcgccactggccgat
gtggatgccctgctggatctgccgctggccgaacgctctgcccgcatcatcaaccacctg
ctgggggatgaagtgcccgccgccaaggtaagcgggctgattaacgccgccttcaccttc
ccgtcaccgctggtgaagctcaaggatggcacctatgccctcgagctgttccacggcccg
accctggcattcaaggattttggcggccgctttatggcccagtgcctcgcgaccttccgc
accaacgacaagatcaccatactcaccgccacctccggcgacaccggcgccgccgtggct
cacgccttctacgggctggaggggatcgaggtggtcattctctaccccaagggcaagata
agccccctgcaggagaagctcttctgcaccctgggcggcaatatccgcaccatcgccatc
gatggcgacttcgatgcctgtcaggcgctggtgaaagatgcctttgacgacgaagcgctg
aaaaaggcgattggcctgaactccgccaactccatcaacatcagccgcttgctggcccag
gtttgctactacttcgaagcagtggcccagttgcccaaagccgaccgcgccaaggcggtt
atcagcgtgccgtccggcaacttcggcaacttgaccgcaggcctgattgccaaggcgctg
gggttgccggtgaagcgctttatcgccgccaccaacgccaacgacacagtgccgcgctac
ctgaaatccggtcagtgggagccacaccagacagttgcgaccctgtcgaatgccatggac
gtgagccgccccaacaactggcctagggtggaagagctgtgccgccgcgaaggctgggcg
ctggaaaccttgggctccggcatgcgtgacgaagctcagacccgcgatgccctcaaacgc
ctgcatcagctggattacctgtgcgagccccacggcgccattgcctgggatctgctgggc
gaacagctggccgaggacgaagtaggggtgttcctgtgcaccgcccatcccgccaagttc
aaggagtcggtggacgagatcctgagtctcgatgtgccgctgcccggcccgcttgccaag
catgctgagctgccgctgctctccgttaatttgccagcggagtttgcccggttaagggcg
tttttggtgggttaa

DBGET integrated database retrieval system