KEGG   Aeromonas salmonicida: ASA_3107Help
Entry
ASA_3107          CDS       T00500                                 

Gene name
chb
Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
asa  Aeromonas salmonicida
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ASA_3107 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ASA_3107 (chb)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ASA_3107 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3353503..3355368
Genome map
AA seq 621 aa AA seqDB search
MSTPLIHTQVDRRDGEDVWFRFSLSQLPAAPWKLHFCLARHIDPASLEGARLERQSGSYK
VLIPAEGQSELRFCCRNTPIKRLSDMPQGFFLSLPEASTGTQLMPVTLVEQELGLPPSGP
GAPDLPEVEPLTGIVPQPDQLVLLEGNFRLAERAHVSGPGSLTGLLAHFNELTGLALEQD
HDAEIRLFEAPLAAEAYRLTITPEGVTIAAAGEAGWRHGLTSLAQWALQHGESLPCIELV
DAPRFGFRGIFLDCARHFHPVANLKRLLKLMSLYKFNRFHWHLTDDEGWRLEIKAFPQLT
EIAAWRGHDLPVGPQLSGGPEPYGGYYTQSEVRELVAYASELGITVIPEIDIPGHCHAAI
KALPGLLIEEADRSRYLSVQYFDDNVLNPALPGTYQFLEAVIDEVCELFPGPLVHMGGDE
VPTGVWTDSPACQQLMQRQGYQDYRELQGHLLRHCQQYLASKGKQMLGWEEILHGDKVSR
DATIFAWTSFQAGLDAAAAGYPVVMAPAQHLYLDLAWSQDPREPGLYWAGTLNLEQVYRC
DPAPADFHANDNILGVLSPLWSELVTSRDRLDYMLFPRMLATAEVAWSDATRKAWDHFAA
RLPGQLQILDQLQVRYRVPQR
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacccctgatccacacccaggttgaccgacgcgatggcgaggacgtctggttc
cgattcagcctgagccagttgccggcagccccctggaaacttcacttctgcctggcacgc
cacatagatcccgcctccctcgaaggtgccagactggagcgccagagcggcagctacaag
gtgctgatcccggccgaggggcaaagcgagctgcgtttttgctgtcgcaacacccccatc
aagcgattgtctgacatgccgcagggcttcttcctgagcctgcccgaggcgagcacgggc
acccagctgatgccggtcaccttggtggaacaagagctgggcctgccgccaagcgggccc
ggcgccccggatctgccagaggtcgagcccctcaccggcatagtgccccagccagatcag
ctggtgctgctggagggcaacttccggctggcggagcgggctcatgtcagcgggcccggg
tcgctgaccggcctgctggcccatttcaacgagctgactgggctagcgctggagcaggat
catgatgccgagatccggctgttcgaggcccccctggctgccgaagcctatcgcctcacc
atcacgcctgagggggtgaccatagccgcagctggcgaggctggctggcgccacggcctg
acaagcctggcccagtgggctctgcagcacggagagagcctgccctgcatcgagctggtc
gatgccccccgcttcggttttcgcggcatcttcctcgactgcgcccgccactttcacccc
gtcgctaacctcaagcgcctgctcaaactgatgagcctctacaagttcaaccgcttccac
tggcatctgaccgatgacgaggggtggcggctcgagatcaaggctttcccgcaactgaca
gaaatcgccgcctggcgtggccacgatctgccagtggggccccagctcagtggcggcccc
gaaccctatggcggctactacacccaaagcgaggtacgcgagctggtggcttatgccagc
gagctcggtattaccgtcatccccgagatcgacatcccgggccactgccacgccgccatc
aaggcgctgcccgggctactgatcgaggaagcggatcgctcccgctacctgtcggtgcaa
tatttcgacgacaacgtgctcaacccggccctgcccggcacctatcagttcctggaggcg
gtaatcgacgaggtgtgcgagctgttcccgggccccttggtacacatggggggggacgag
gtaccgaccggagtatggaccgacagcccggcctgccagcagttgatgcaacggcaggga
tatcaggattaccgcgagctgcagggccacctgctgcgccactgccaacagtatctggcc
agcaagggcaagcagatgctgggttgggaggagatattgcacggcgacaaggtaagccgg
gatgccaccatcttcgcctggaccagcttccaggcagggctggatgccgcggctgcgggc
tatcccgttgtgatggcaccggcccagcacctctatctggatctggcctggagccaggat
ccccgagaacccggcctctactgggcgggcaccctcaatctggagcaggtctatcgatgt
gatcctgccccggccgatttccatgccaacgataacatcctgggggtgctgagcccctta
tggtcggaactggttacctctcgtgaccgtctcgactatatgttgttcccgcgcatgctg
gccaccgccgaggtggcctggagcgacgccacccgcaaggcgtgggatcacttcgccgcc
cgcctgccgggccagctgcagatcctcgaccagctacaggtgcgttatcgggtgccacag
aggtag

DBGET integrated database retrieval system