KEGG   Aeromonas salmonicida: ASA_3107Help
Entry
ASA_3107          CDS       T00500                                 

Gene name
chb
Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
asa  Aeromonas salmonicida
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:asa00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:asa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3353503..3355368
Genome map
AA seq 621 aa AA seqDB search
MSTPLIHTQVDRRDGEDVWFRFSLSQLPAAPWKLHFCLARHIDPASLEGARLERQSGSYK
VLIPAEGQSELRFCCRNTPIKRLSDMPQGFFLSLPEASTGTQLMPVTLVEQELGLPPSGP
GAPDLPEVEPLTGIVPQPDQLVLLEGNFRLAERAHVSGPGSLTGLLAHFNELTGLALEQD
HDAEIRLFEAPLAAEAYRLTITPEGVTIAAAGEAGWRHGLTSLAQWALQHGESLPCIELV
DAPRFGFRGIFLDCARHFHPVANLKRLLKLMSLYKFNRFHWHLTDDEGWRLEIKAFPQLT
EIAAWRGHDLPVGPQLSGGPEPYGGYYTQSEVRELVAYASELGITVIPEIDIPGHCHAAI
KALPGLLIEEADRSRYLSVQYFDDNVLNPALPGTYQFLEAVIDEVCELFPGPLVHMGGDE
VPTGVWTDSPACQQLMQRQGYQDYRELQGHLLRHCQQYLASKGKQMLGWEEILHGDKVSR
DATIFAWTSFQAGLDAAAAGYPVVMAPAQHLYLDLAWSQDPREPGLYWAGTLNLEQVYRC
DPAPADFHANDNILGVLSPLWSELVTSRDRLDYMLFPRMLATAEVAWSDATRKAWDHFAA
RLPGQLQILDQLQVRYRVPQR
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacccctgatccacacccaggttgaccgacgcgatggcgaggacgtctggttc
cgattcagcctgagccagttgccggcagccccctggaaacttcacttctgcctggcacgc
cacatagatcccgcctccctcgaaggtgccagactggagcgccagagcggcagctacaag
gtgctgatcccggccgaggggcaaagcgagctgcgtttttgctgtcgcaacacccccatc
aagcgattgtctgacatgccgcagggcttcttcctgagcctgcccgaggcgagcacgggc
acccagctgatgccggtcaccttggtggaacaagagctgggcctgccgccaagcgggccc
ggcgccccggatctgccagaggtcgagcccctcaccggcatagtgccccagccagatcag
ctggtgctgctggagggcaacttccggctggcggagcgggctcatgtcagcgggcccggg
tcgctgaccggcctgctggcccatttcaacgagctgactgggctagcgctggagcaggat
catgatgccgagatccggctgttcgaggcccccctggctgccgaagcctatcgcctcacc
atcacgcctgagggggtgaccatagccgcagctggcgaggctggctggcgccacggcctg
acaagcctggcccagtgggctctgcagcacggagagagcctgccctgcatcgagctggtc
gatgccccccgcttcggttttcgcggcatcttcctcgactgcgcccgccactttcacccc
gtcgctaacctcaagcgcctgctcaaactgatgagcctctacaagttcaaccgcttccac
tggcatctgaccgatgacgaggggtggcggctcgagatcaaggctttcccgcaactgaca
gaaatcgccgcctggcgtggccacgatctgccagtggggccccagctcagtggcggcccc
gaaccctatggcggctactacacccaaagcgaggtacgcgagctggtggcttatgccagc
gagctcggtattaccgtcatccccgagatcgacatcccgggccactgccacgccgccatc
aaggcgctgcccgggctactgatcgaggaagcggatcgctcccgctacctgtcggtgcaa
tatttcgacgacaacgtgctcaacccggccctgcccggcacctatcagttcctggaggcg
gtaatcgacgaggtgtgcgagctgttcccgggccccttggtacacatggggggggacgag
gtaccgaccggagtatggaccgacagcccggcctgccagcagttgatgcaacggcaggga
tatcaggattaccgcgagctgcagggccacctgctgcgccactgccaacagtatctggcc
agcaagggcaagcagatgctgggttgggaggagatattgcacggcgacaaggtaagccgg
gatgccaccatcttcgcctggaccagcttccaggcagggctggatgccgcggctgcgggc
tatcccgttgtgatggcaccggcccagcacctctatctggatctggcctggagccaggat
ccccgagaacccggcctctactgggcgggcaccctcaatctggagcaggtctatcgatgt
gatcctgccccggccgatttccatgccaacgataacatcctgggggtgctgagcccctta
tggtcggaactggttacctctcgtgaccgtctcgactatatgttgttcccgcgcatgctg
gccaccgccgaggtggcctggagcgacgccacccgcaaggcgtgggatcacttcgccgcc
cgcctgccgggccagctgcagatcctcgaccagctacaggtgcgttatcgggtgccacag
aggtag

DBGET integrated database retrieval system