KEGG   Aeromonas salmonicida: ASA_3272Help
Entry
ASA_3272          CDS       T00500                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
asa  Aeromonas salmonicida
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:asa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:asa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3538405..3539466
Genome map
AA seq 353 aa AA seqDB search
MKQIKVMLVDDSAVVRQVLQAILEQEPDIKVIATASDPLFALEKLKKEWPDVIVLDVEMP
RMDGITFLTKIMAEHPTPVVICSSLTEKGAETTLQAMAAGAVDIITKPTVGLKSFLQESA
QALAMAVRAAAQANVKRLGKAPPLIVAAKLSADAIMPPASQHAMAQTTERIVAIGTSTGG
TQALEAVLTNLPRVCPGIVIVQHMPEKFTASFAERLNNLCQIEVREAKSNDRVIPGLALI
APGGKHMLLKRSGAYYHVDVMDGPLINRHRPSVDVLFRSVAKFAGGNATGIIMTGMGDDG
ARGLREMLEAGANTFAQDEASCVVFGMPKEAIKLGAARHILPLQDIHHAIVGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcaaggtcatgctggtggacgactccgccgtggtcaggcaggtattacag
gccattctcgaacaggagccggacatcaaggtgatagccaccgcctcggatccgctgttt
gcactggaaaaactgaaaaaagagtggcccgacgtgatagtgctggacgtggagatgcca
cgcatggatggcatcaccttcctcaccaagatcatggccgaacaccctaccccggtagtc
atctgctcgtccctgacagagaaaggcgcggaaacaacgctgcaggccatggccgccgga
gcggtggacatcatcaccaagcccacggtcggcctcaaaagcttcttgcaggagtcggca
caagccttggccatggcggtgcgcgcagccgcccaggccaatgtcaaacggctgggcaag
gcgcccccgttgatcgtggcggccaaactcagcgccgatgccatcatgccgccagcaagc
cagcatgccatggcccagaccacggagcggatcgtggcgatcggtacctccaccggcggt
acccaggcactggaagccgtgctgacgaacctgccacgggtctgtcccggcatcgtcata
gtgcagcacatgccggagaagttcactgcctcctttgccgagcggctcaacaacctgtgc
cagatcgaggtgagagaggccaaaagcaacgacagggtcattccgggtctggcactcata
gcccccggcggcaagcacatgctgctcaagcgcagcggcgcctattatcacgtcgatgtc
atggatggccccctcatcaaccgccatcgcccctcggtggatgtgctgtttcgctcggtc
gccaagtttgccggcggcaatgccaccggcatcataatgacgggcatgggagatgacggc
gctcgcgggttacgggaaatgctggaggcgggggccaacaccttcgcccaggatgaggcg
tcctgcgtggtgttcggcatgcccaaggaggctatcaagctcggggctgcccgccacata
ctgccgctgcaggatattcaccacgccatagtgggtcgataa

DBGET integrated database retrieval system