KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3376Help
Entry
ASA_3376          CDS       T00500                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00010  Glycolysis / Gluconeogenesis
asa00520  Amino sugar and nucleotide sugar metabolism
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
asa01200  Carbon metabolism
Module
asa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASA_3376
   00520 Amino sugar and nucleotide sugar metabolism
    ASA_3376
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ASA_3376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABO91353
UniProt: A4SR31
Position
3652088..3652837
Genome map
AA seq 249 aa AA seqDB search
MQMLGVDIGGSGIKGCLVDTETGELIGERHRLATPQPATPAAVAHTLKALVEHFQWKGPV
GCGFPATIHNGIAKSAANIDKSWIETDAAHLFSDVTGLPCHVLNDADAAGLAEMRFGAGK
DRKGIIILITVGTGIGTAVFVNGQLLPNTELGHLMLEGMVAEHYCSDAVRKREDLSWSRW
GKRFNKYLARLEFLFSPDLFILGGGSSAKLDKFIDRIETRAPLVAAASLNQAGIIGAALH
AAERSAEQQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgttgggagtggatatcggtggctcagggatcaagggatgcctggtcgatacc
gaaacaggcgagctgattggcgaacgccaccgtctggcaacaccgcaaccggcgaccccg
gcggccgtggcacataccctcaaggcactggtagaacacttccaatggaagggccctgtg
ggttgcggctttcccgccaccatccacaacggcattgccaagagcgcagccaacatcgac
aagagctggatcgagaccgatgctgcccacctgttttcggatgtgaccggcctgccctgc
catgtgctcaacgatgccgatgcggcgggtctggccgagatgcgctttggtgccggcaag
gatcgcaaggggatcatcatcctcatcactgttggtaccggcataggtactgccgtgttc
gtcaacggccagctgctgcccaacaccgagctgggtcacctgatgctggaaggcatggta
gccgagcactactgttcggatgcggtgcgcaagcgggaggatctctcctggagccgctgg
ggaaaacgcttcaacaagtatttggccagactggagtttctgttctcccccgacctcttt
atcctggggggcggcagctcagccaagctcgacaaattcatcgatcgcatcgaaacccgc
gcgccgctggtggcagccgccagtctcaatcaggctggcatcataggggctgcccttcat
gcggccgaacgcagcgccgaacagcagtaa

DBGET integrated database retrieval system