KEGG   Aeromonas salmonicida: ASA_3469Help
Entry
ASA_3469          CDS       T00500                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
asa  Aeromonas salmonicida
Brite
Enzymes [BR:asa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ASA_3469 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3759292..3759909)
Genome map
AA seq 205 aa AA seqDB search
MIVQRLLNQLIAQDIRDFRVLAAIAKVPRQLFVDEAMAHKAWDNTALPIGNGQTISQPYM
VARMTELLIQNDPAHVLEIGTGSGYQTAVLAHLVEHVYTVERIKSLQFQARRRLRQLDLH
NVSAKHGNGWLGWPNKGPFDAILVTAAASEVPTALTDQLADGGRLVLPVGDSHQTLQLIE
RAGSQLTSRILEPVRFVPLIDGDVE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagtacagcgcctgttgaaccagctgatcgcacaggacattcgtgatttccgcgta
ctcgcggcgattgcgaaagtaccgcgccagctgtttgtggatgaagccatggcccacaag
gcatgggataacacggcgttgcccatcggcaatggtcagaccatctcccagccttacatg
gtggcgcggatgaccgagctgctgatccagaatgatccggcccacgtgctggagattggt
actggttccggttaccagaccgccgtgctggcacatctggtggagcacgtctatacggtg
gagcggatcaagtcgctgcagttccaggcccggcgccgactgcgccagcttgatctgcac
aacgtctcggccaagcacggcaacggctggctgggatggcccaataaagggccgttcgat
gcaattctggtgacggccgcggccagtgaagtgcctactgctctcaccgatcaactggcc
gatggtggccgtctggtgctgccggtaggtgatagtcatcagaccttgcagctaatcgaa
cgggctggttcccagctgaccagccggatcctggagcctgtgcgctttgttcccctaatt
gatggagatgttgagtga

DBGET integrated database retrieval system