KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3790Help
Entry
ASA_3790          CDS       T00500                                 

Gene name
cysQ
Definition
(GenBank) CysQ protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00920  Sulfur metabolism
asa01100  Metabolic pathways
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ASA_3790 (cysQ)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ASA_3790 (cysQ)
Transfer RNA biogenesis [BR:asa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ASA_3790 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: ABO91751
UniProt: A4SS79
Position
4082997..4083809
Genome map
AA seq 270 aa AA seqDB search
MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTSADLAADAYLKQALSAL
TPHVPVLTEEAADVPFSQRSNWRQYWLVDPLDGTGEFIAGSGDFATLIALVRDNVPVLGV
IYAPESDVLYWAVRGHGAFKEVNGETLPISAMHHEHDQPDSLVVAISRRQKLENLTRRLN
PAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWDTAAAQCIVEAAGGRILSLALQP
LSYNETESLENPDFIVMGDPDLAWGTILAH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagttgttggcctgggttccaggggtcaaggagatcgcccgcgaagcgggacgt
atccttcacgaaatctatcacggcggtcagttcgagcgtcagctgaaggaggatgcgacc
ccggtcaccagtgccgatcttgctgccgatgcctacctcaaacaggcgctgtcggcgctc
accccccatgtacccgtgctgaccgaagaggcggccgatgtgcccttcagtcagcgatcc
aactggcggcagtactggctggtggatcccctcgacggcactggtgagttcattgccggc
agcggcgatttcgccaccctgatcgccctggttcgggacaacgtgccggtgctcggtgtc
atctacgcccccgagtctgacgtgctctactgggcggtgcgtggtcacggcgccttcaag
gaggtgaacggcgagaccttgcctatcagcgccatgcatcacgaacatgaccagccagac
tccctggtggtggccatcagccgtcgccagaagctggagaatctgacccgtcgcctcaat
ccggccatcaactacgagctgatcccgctcggttccagctccctcaagtcctgcctggtg
gcagaaggggctgccgattgctatgtgcgactcggccccaccggcgagtgggataccgcc
gctgcacagtgcatcgtcgaggcggctggcggtcgtatcctcagcctggcgttgcaaccg
cttagctacaacgaaaccgagtcgctggagaacccggactttatagtgatgggagatccg
gatctcgcctggggcactattctcgctcactga

DBGET integrated database retrieval system