KEGG   Aeromonas salmonicida: ASA_3790Help
Entry
ASA_3790          CDS       T00500                                 

Gene name
cysQ
Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
asa  Aeromonas salmonicida
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:asa00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4082997..4083809
Genome map
AA seq 270 aa AA seqDB search
MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTSADLAADAYLKQALSAL
TPHVPVLTEEAADVPFSQRSNWRQYWLVDPLDGTGEFIAGSGDFATLIALVRDNVPVLGV
IYAPESDVLYWAVRGHGAFKEVNGETLPISAMHHEHDQPDSLVVAISRRQKLENLTRRLN
PAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWDTAAAQCIVEAAGGRILSLALQP
LSYNETESLENPDFIVMGDPDLAWGTILAH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagttgttggcctgggttccaggggtcaaggagatcgcccgcgaagcgggacgt
atccttcacgaaatctatcacggcggtcagttcgagcgtcagctgaaggaggatgcgacc
ccggtcaccagtgccgatcttgctgccgatgcctacctcaaacaggcgctgtcggcgctc
accccccatgtacccgtgctgaccgaagaggcggccgatgtgcccttcagtcagcgatcc
aactggcggcagtactggctggtggatcccctcgacggcactggtgagttcattgccggc
agcggcgatttcgccaccctgatcgccctggttcgggacaacgtgccggtgctcggtgtc
atctacgcccccgagtctgacgtgctctactgggcggtgcgtggtcacggcgccttcaag
gaggtgaacggcgagaccttgcctatcagcgccatgcatcacgaacatgaccagccagac
tccctggtggtggccatcagccgtcgccagaagctggagaatctgacccgtcgcctcaat
ccggccatcaactacgagctgatcccgctcggttccagctccctcaagtcctgcctggtg
gcagaaggggctgccgattgctatgtgcgactcggccccaccggcgagtgggataccgcc
gctgcacagtgcatcgtcgaggcggctggcggtcgtatcctcagcctggcgttgcaaccg
cttagctacaacgaaaccgagtcgctggagaacccggactttatagtgatgggagatccg
gatctcgcctggggcactattctcgctcactga

DBGET integrated database retrieval system