KEGG   Aeromonas salmonicida: ASA_3876Help
Entry
ASA_3876          CDS       T00500                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
asa  Aeromonas salmonicida
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASA_3876 (hemD)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ASA_3876 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4162762..4163496
Genome map
AA seq 244 aa AA seqDB search
MIPLVVRPAAQAAELVQLLRQHGHAPLCCPLLETAAGSELPRLPELLPQADIVIAVSVHA
VHFTHHFLLQTGQTWPSIDYFAVGQASADAFADVGIEASCPDDPRSEGLLALPALQQVSG
KRVLILRGNGGRDLIARTLASRGALVHYCAAYERHYPELDGDTLTRHWQAAGLDSLLITS
GELLQRLLELVPGQQQPWLYDRLLVVPSPRVADMAKMAGFTHITIAQGASNQALTAALEL
RKME
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatacccctggtggtgcgcccggccgctcaggccgccgagctggtgcaactgctgcgc
cagcacggccacgcaccgctctgctgtccactgcttgaaacggcagcgggcagcgaactc
ccccgcctgcccgaactgctgccccaggctgacatcgtcatcgcagtcagcgtgcatgca
gttcatttcactcatcattttctgttgcaaactggtcagacctggccaagtattgactac
tttgcggtcggccaggccagcgcggatgccttcgccgacgtcggtatagaggcgagctgc
cctgacgatccccgtagcgaagggctgctggccctgcccgccctgcaacaggtgagcggc
aagcgggtattgatactcagaggcaacgggggccgggatcttatcgcccggacgctggcc
tcacgcggtgctctggtgcactattgtgcggcctatgagcgccactaccccgaactcgac
ggggacacattgactcgccattggcaggcagccgggctcgacagcctgctcattaccagt
ggtgaactgttgcaacggctgctggagctggtgccaggccagcagcagccctggctttat
gaccgcctcttggtggtgcccagcccccgcgtggccgacatggccaagatggcgggcttt
acccatatcacgattgcccagggtgcatccaaccaggccctgacggccgctctggaactg
aggaagatggaatga

DBGET integrated database retrieval system