KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3966Help
Entry
ASA_3966          CDS       T00500                                 

Definition
(GenBank) stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa01040  Biosynthesis of unsaturated fatty acids
asa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ASA_3966
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ASA_3966
Lipid biosynthesis proteins [BR:asa01004]
 Desaturase
  First
   ASA_3966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Phage_Mu_Gam RRP36
Motif
Other DBs
NCBI-ProteinID: ABO91918
UniProt: A4SSP6
Position
4259147..4260265
Genome map
AA seq 372 aa AA seqDB search
MERPPIIMTNTLLFALSGLTALIAVPWYGMTHGYDLWQWSCFLLLFCYSGISITAGYHRL
WSHKAYKAHRILQWIFAIGGALALQNSALHWSSDHRRHHRHVDDNLKDPYSAGRGFWYSH
IGWMLREYQREIYNDYSNVRDLQNNPIVAFQHKHYLALTLATNLGIPLLLGLVHGDLLGM
LLLAGVLRMVMTHHTTFFINSLAHIWGSQPFTDRNTARDNGILAFFTFGEGYHNFHHLFE
NDYRNGIRWWQFDPTKWLIRSASWCGLARDLRSCPEERIEQARLEMQLKRAQAKLRKRED
RELWQALLQEEYDKLSQQLQLYYASRKSLLEQRKRKALASYDKLKLQLEYRNLHDGFVAS
KRNWSRLLAGIA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcccacctatcatcatgaccaacaccctgctgtttgccctctccgggctgacc
gcactgatcgccgtgccctggtacggtatgacccatggctatgacctctggcagtggagc
tgcttcctgctgctgttctgttacagcggcatctccatcacagccggttatcaccgcctc
tggtcgcacaaggcctacaaggcccaccggatcctgcagtggatcttcgccatcggcggc
gccctcgccctgcagaactcggccctgcactggtcttccgaccatcgccgtcaccatcgc
catgtggatgacaacctgaaggatccctacagcgcgggtcgcggcttctggtattcacac
attggctggatgctgcgcgagtaccaacgcgagatctataacgattacagcaacgtgcgg
gatctgcagaacaaccccatcgttgccttccagcacaagcactatctggcgctgaccctg
gccaccaatctgggcattccgctgctgctggggcttgtccacggcgatctgctcggcatg
ctgctgctggcaggggtgctgcgcatggtgatgacccaccacaccaccttcttcatcaac
tccctggcccacatctggggcagtcagccatttactgaccgcaacacggcaagggacaac
ggcatcctggccttcttcaccttcggcgagggttatcacaacttccaccacctgttcgaa
aacgactaccgcaacggcatccgctggtggcagttcgatcccaccaagtggctgatccgc
agcgcctcctggtgcgggctggcccgggatctgaggtcctgcccggaagagcggatcgaa
caggcaagacttgagatgcaactcaagcgcgcccaggccaaattgcgcaaacgcgaagac
agggagctgtggcaggcattgttgcaggaggagtacgacaaactgagccagcagttgcag
ctctactatgccagccgcaagtctctgctggagcagcgcaaacgcaaggcgctggccagc
tacgataagctgaaactgcaactggaatatcgcaacctgcacgacggcttcgttgccagc
aagcgcaactggagccggttgctggcgggcatcgcctga

DBGET integrated database retrieval system