KEGG   Aeromonas salmonicida: ASA_3966Help
Entry
ASA_3966          CDS       T00500                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
asa  Aeromonas salmonicida
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:asa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:asa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4259147..4260265
Genome map
AA seq 372 aa AA seqDB search
MERPPIIMTNTLLFALSGLTALIAVPWYGMTHGYDLWQWSCFLLLFCYSGISITAGYHRL
WSHKAYKAHRILQWIFAIGGALALQNSALHWSSDHRRHHRHVDDNLKDPYSAGRGFWYSH
IGWMLREYQREIYNDYSNVRDLQNNPIVAFQHKHYLALTLATNLGIPLLLGLVHGDLLGM
LLLAGVLRMVMTHHTTFFINSLAHIWGSQPFTDRNTARDNGILAFFTFGEGYHNFHHLFE
NDYRNGIRWWQFDPTKWLIRSASWCGLARDLRSCPEERIEQARLEMQLKRAQAKLRKRED
RELWQALLQEEYDKLSQQLQLYYASRKSLLEQRKRKALASYDKLKLQLEYRNLHDGFVAS
KRNWSRLLAGIA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcccacctatcatcatgaccaacaccctgctgtttgccctctccgggctgacc
gcactgatcgccgtgccctggtacggtatgacccatggctatgacctctggcagtggagc
tgcttcctgctgctgttctgttacagcggcatctccatcacagccggttatcaccgcctc
tggtcgcacaaggcctacaaggcccaccggatcctgcagtggatcttcgccatcggcggc
gccctcgccctgcagaactcggccctgcactggtcttccgaccatcgccgtcaccatcgc
catgtggatgacaacctgaaggatccctacagcgcgggtcgcggcttctggtattcacac
attggctggatgctgcgcgagtaccaacgcgagatctataacgattacagcaacgtgcgg
gatctgcagaacaaccccatcgttgccttccagcacaagcactatctggcgctgaccctg
gccaccaatctgggcattccgctgctgctggggcttgtccacggcgatctgctcggcatg
ctgctgctggcaggggtgctgcgcatggtgatgacccaccacaccaccttcttcatcaac
tccctggcccacatctggggcagtcagccatttactgaccgcaacacggcaagggacaac
ggcatcctggccttcttcaccttcggcgagggttatcacaacttccaccacctgttcgaa
aacgactaccgcaacggcatccgctggtggcagttcgatcccaccaagtggctgatccgc
agcgcctcctggtgcgggctggcccgggatctgaggtcctgcccggaagagcggatcgaa
caggcaagacttgagatgcaactcaagcgcgcccaggccaaattgcgcaaacgcgaagac
agggagctgtggcaggcattgttgcaggaggagtacgacaaactgagccagcagttgcag
ctctactatgccagccgcaagtctctgctggagcagcgcaaacgcaaggcgctggccagc
tacgataagctgaaactgcaactggaatatcgcaacctgcacgacggcttcgttgccagc
aagcgcaactggagccggttgctggcgggcatcgcctga

DBGET integrated database retrieval system