KEGG   Aeromonas salmonicida: ASA_4020Help
Entry
ASA_4020          CDS       T00500                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asa  Aeromonas salmonicida
Pathway
asa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:asa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ASA_4020 (recD)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ASA_4020 (recD)
DNA repair and recombination proteins [BR:asa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ASA_4020 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 AAA_22 UvrD-helicase AAA_16 AAA_28 CbiA UvrD_C NTPase_1 T2SSE SRP54 AAA_24 DUF2075
Motif
Other DBs
NCBI-ProteinID: ABO91968
UniProt: A4SSU6
Position
complement(4315539..4317563)
Genome map
AA seq 674 aa AA seqDB search
MIERLKALALAGRIRQLDLQFAKLVADLGGSPELVLGAALTCFELGRGHVCLQLEMLAAG
SLRPFGLDPQQSRDLLADLADPARWPALFAASPLVGTEQDDGLAPRWPLRLWHGRLYLTR
YHDHEQGVARHLRALSERAEWPEIAPALSRLFARDYGLVFGALLKARLAPDFSARHFIEK
YLDLVFPSEVDWPAIEGLLASAQAASDLDQLDALVPEALCCNGQKLAAATAAARPFAVIS
GGPGTGKTTTVAKLLAILVETGLQAGKAPAIRLVAPTGKAAARLTESIGSALQALDLPPE
WVEAIPTEAGTLHRLLGVIPGRSQFRHHAGNPLHLDLLVVDEASMVDLPMMARLLDALPS
HARLILLGDKDQLASVEAGAVLGDICSFIEQGISPAQADWLSRQTGYRLQGTPAGAPVRD
SLCLLAKSWRFDQHSGIGQLARACNSGDATAVESVWGMGFADISLHPWVGEAYNALIAQG
VAGYGAYLKAARAGEEPATVFKAFNSFQILCALRDGPFGVLGLNERLELALSRAGLIARD
GDWYAGRPVMVVRNDHGVGLYNGDMGLCLPDETGRLKVWFEQPDGTLRALLPSRLPPHET
VYAMTIHKSQGSEFAHTVLVLPDSPSPLLTRELVYTGITRAKACLDLYGDRALLAQAVRK
KTERYSGLAERLGE
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacggttgaaagcactggcgctggcggggcgtatccgccagctggatctgcaa
tttgccaagctggtggccgatcttggcggcagccccgagctggtgttgggggcggcgctc
acctgcttcgagctggggcgcggccacgtctgcctgcagcttgagatgctggctgccgga
tcattgcgcccgttcgggctggatccccagcagagtagggatctgctggctgatctggcg
gatcctgcccgctggcccgccctgtttgcggcaagcccgctcgttggtaccgagcaggat
gacgggctcgctccgcgctggccgctgcggctgtggcacgggcggctctacctcacccgc
taccacgatcacgaacagggggtggcccgccatctgcgagccttgagtgaaagagccgaa
tggccggagatagccccggccctgtcgcggctgtttgcccgcgactacgggctggtgttc
ggggcgctgctgaaagcccgcctagcccccgacttctcggcccgccactttatcgagaag
tatctcgacctggtgttcccgagcgaagtggattggcccgccatcgaagggctgttggcc
agcgcgcaggcggcgagcgatcttgaccagctggatgcgctggtgcccgaggcgctctgt
tgcaacggccagaagctggcggcggctaccgcggcggcgcgcccctttgccgtgatctcc
ggcggccccggcaccggcaagaccacgactgtggccaaactgctcgccattctggtggag
accggcctgcaagcgggcaaggccccggcgatccggctggtggcccccaccggcaaggcg
gcggcgcgtctcaccgagagtatcggctctgccctgcaggcgctggacttgccccccgag
tgggtggaagccatccccaccgaagcgggcaccttgcaccggctgctcggtgtgatcccg
gggcgcagccagttccgccaccacgcaggcaacccgctgcacctcgacttgctggtggtg
gatgaggcctccatggtcgacctgcccatgatggcgcgcctgctcgatgcgctgcccagc
cacgcccgcctgatcctgctcggcgacaaggatcagctcgcctcggtggaggcgggggcc
gtgctcggcgatatctgcagctttatcgaacagggcatcagccccgcgcaggcggattgg
ctctcccgccagaccggctaccgcttgcagggcacaccagcgggggcaccggtgcgtgac
agcctctgcctgctggccaagagctggcgctttgatcagcactccggcatcggccagctg
gcgcgcgcctgcaacagcggcgatgccactgcggtggaatcagtctggggtatgggcttt
gccgatatcagcctgcacccctgggtcggggaggcttacaacgccctgattgcccagggg
gtggccggttacggcgcttatcttaaggcggcccgcgcaggggaggagcccgcgaccgtg
ttcaaggcattcaacagcttccagatcctctgcgccctgcgcgatggcccgttcggggtg
ttgggtcttaacgagcgcctcgaactggccctgtcacgggccgggctgatcgcccgcgac
ggtgactggtatgccggtcgccctgtgatggtggtgcgcaacgaccacggggttggcctc
tacaacggcgatatggggctctgtctgcccgatgaaactggtcgcctcaaggtatggttt
gagcagccggatggcaccctgcgggcactcttgcccagccgcctgccacctcacgagact
gtctacgccatgaccatccacaaatcccagggctcggagtttgcccatacagtgctggtg
ctgcccgacagccctagcccgcttttgacccgcgagctggtctataccggcatcacccgg
gccaaggcgtgcctcgatctctacggcgatcgcgccctgctggcacaagcggtacggaaa
aagaccgagcgttattccggattggcggagaggttgggggagtga

DBGET integrated database retrieval system