KEGG   Aeromonas salmonicida: ASA_4020Help
Entry
ASA_4020          CDS       T00500                                 

Gene name
recD
Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asa  Aeromonas salmonicida
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ASA_4020 (recD)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ASA_4020 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4315539..4317563)
Genome map
AA seq 674 aa AA seqDB search
MIERLKALALAGRIRQLDLQFAKLVADLGGSPELVLGAALTCFELGRGHVCLQLEMLAAG
SLRPFGLDPQQSRDLLADLADPARWPALFAASPLVGTEQDDGLAPRWPLRLWHGRLYLTR
YHDHEQGVARHLRALSERAEWPEIAPALSRLFARDYGLVFGALLKARLAPDFSARHFIEK
YLDLVFPSEVDWPAIEGLLASAQAASDLDQLDALVPEALCCNGQKLAAATAAARPFAVIS
GGPGTGKTTTVAKLLAILVETGLQAGKAPAIRLVAPTGKAAARLTESIGSALQALDLPPE
WVEAIPTEAGTLHRLLGVIPGRSQFRHHAGNPLHLDLLVVDEASMVDLPMMARLLDALPS
HARLILLGDKDQLASVEAGAVLGDICSFIEQGISPAQADWLSRQTGYRLQGTPAGAPVRD
SLCLLAKSWRFDQHSGIGQLARACNSGDATAVESVWGMGFADISLHPWVGEAYNALIAQG
VAGYGAYLKAARAGEEPATVFKAFNSFQILCALRDGPFGVLGLNERLELALSRAGLIARD
GDWYAGRPVMVVRNDHGVGLYNGDMGLCLPDETGRLKVWFEQPDGTLRALLPSRLPPHET
VYAMTIHKSQGSEFAHTVLVLPDSPSPLLTRELVYTGITRAKACLDLYGDRALLAQAVRK
KTERYSGLAERLGE
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacggttgaaagcactggcgctggcggggcgtatccgccagctggatctgcaa
tttgccaagctggtggccgatcttggcggcagccccgagctggtgttgggggcggcgctc
acctgcttcgagctggggcgcggccacgtctgcctgcagcttgagatgctggctgccgga
tcattgcgcccgttcgggctggatccccagcagagtagggatctgctggctgatctggcg
gatcctgcccgctggcccgccctgtttgcggcaagcccgctcgttggtaccgagcaggat
gacgggctcgctccgcgctggccgctgcggctgtggcacgggcggctctacctcacccgc
taccacgatcacgaacagggggtggcccgccatctgcgagccttgagtgaaagagccgaa
tggccggagatagccccggccctgtcgcggctgtttgcccgcgactacgggctggtgttc
ggggcgctgctgaaagcccgcctagcccccgacttctcggcccgccactttatcgagaag
tatctcgacctggtgttcccgagcgaagtggattggcccgccatcgaagggctgttggcc
agcgcgcaggcggcgagcgatcttgaccagctggatgcgctggtgcccgaggcgctctgt
tgcaacggccagaagctggcggcggctaccgcggcggcgcgcccctttgccgtgatctcc
ggcggccccggcaccggcaagaccacgactgtggccaaactgctcgccattctggtggag
accggcctgcaagcgggcaaggccccggcgatccggctggtggcccccaccggcaaggcg
gcggcgcgtctcaccgagagtatcggctctgccctgcaggcgctggacttgccccccgag
tgggtggaagccatccccaccgaagcgggcaccttgcaccggctgctcggtgtgatcccg
gggcgcagccagttccgccaccacgcaggcaacccgctgcacctcgacttgctggtggtg
gatgaggcctccatggtcgacctgcccatgatggcgcgcctgctcgatgcgctgcccagc
cacgcccgcctgatcctgctcggcgacaaggatcagctcgcctcggtggaggcgggggcc
gtgctcggcgatatctgcagctttatcgaacagggcatcagccccgcgcaggcggattgg
ctctcccgccagaccggctaccgcttgcagggcacaccagcgggggcaccggtgcgtgac
agcctctgcctgctggccaagagctggcgctttgatcagcactccggcatcggccagctg
gcgcgcgcctgcaacagcggcgatgccactgcggtggaatcagtctggggtatgggcttt
gccgatatcagcctgcacccctgggtcggggaggcttacaacgccctgattgcccagggg
gtggccggttacggcgcttatcttaaggcggcccgcgcaggggaggagcccgcgaccgtg
ttcaaggcattcaacagcttccagatcctctgcgccctgcgcgatggcccgttcggggtg
ttgggtcttaacgagcgcctcgaactggccctgtcacgggccgggctgatcgcccgcgac
ggtgactggtatgccggtcgccctgtgatggtggtgcgcaacgaccacggggttggcctc
tacaacggcgatatggggctctgtctgcccgatgaaactggtcgcctcaaggtatggttt
gagcagccggatggcaccctgcgggcactcttgcccagccgcctgccacctcacgagact
gtctacgccatgaccatccacaaatcccagggctcggagtttgcccatacagtgctggtg
ctgcccgacagccctagcccgcttttgacccgcgagctggtctataccggcatcacccgg
gccaaggcgtgcctcgatctctacggcgatcgcgccctgctggcacaagcggtacggaaa
aagaccgagcgttattccggattggcggagaggttgggggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system