KEGG   Aeromonas salmonicida: ASA_4302Help
Entry
ASA_4302          CDS       T00500                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
asa  Aeromonas salmonicida
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASA_4302 (hemB)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ASA_4302 (hemB)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASA_4302 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4604549..4605568)
Genome map
AA seq 339 aa AA seqDB search
MATTLPGAFPGRRLRRVRKHDFSRRLVRENVLTANDLIYPVFVLEGENRREAVTSMPGVD
RLSIDLLLAEAEELVALGVPAIALFPVTPLESKSLLAEEAYNPDGLAQRATRALKARFPE
LGVITDVALDPFTTHGQDGIIDDEGYVLNDITTDILVKQALSHAAAGADIVAPSDMMDGR
IGAIRAALEANGFINVQIMAYSAKYASCYYGPFRDAVGSAGNLGKSNKATYQMDPANSNE
ALHEVALDIQEGADSVMVKPGMPYLDVIRQVKDQFGVPTFAYQVSGEYAMHMAAIQNGWL
KEKESIMESLLCFKRAGADGILTYFAKRVAQWLQEDARR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctacaactcttccgggcgcctttccgggtcgccgtctgcgccgggtgcgcaaacat
gatttcagccgtcgtctggtgcgcgagaacgtactgaccgccaacgatctcatctatccc
gtgttcgtgctggagggggagaaccgtcgtgaggccgtcacctccatgccgggggtggat
cgtctctccatcgacctgctgctggcggaagccgaagagctggtcgccctcggcgtgccc
gccattgcgctcttcccggtgaccccgctggagagcaagagcctgttggcggaagaagct
tacaacccggacggtctggcccagcgggcgacccgcgccctcaaggctcgtttccccgag
ctgggggtcattacggacgtagcgctcgaccccttcaccacccatggccaggacggcatc
atagatgatgaaggctatgtgctgaacgacatcaccacggacatcctggtgaagcaggcg
ctttcccacgccgccgccggggccgatatcgttgcgccgtccgacatgatggatggccgc
atcggcgcgattcgcgccgcactggaagcgaacggcttcatcaatgtccagatcatggcc
tactccgccaagtatgcctcctgctactacggcccgttccgcgatgcggtgggctctgcc
ggcaacctcggcaagagcaacaaggccacctatcagatggatccggccaacagcaacgaa
gccctgcacgaagtggcgctggatattcaggaaggggctgacagcgtcatggtcaagccg
ggcatgccctacttggacgtgatccgtcaggtgaaggatcagttcggcgtgccgactttt
gcttatcaggtgagcggcgagtacgccatgcacatggcggcgatccagaacggctggctg
aaggagaaggagagcatcatggagtccctgctctgcttcaagcgagccggtgccgatggc
attctcacctacttcgccaaacgggttgcccagtggctgcaggaagacgccagacgctga

DBGET integrated database retrieval system