KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_4302Help
Entry
ASA_4302          CDS       T00500                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00860  Porphyrin and chlorophyll metabolism
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
Module
asa_M00121  Heme biosynthesis, glutamate => heme
asa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASA_4302 (hemB)
Enzymes [BR:asa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ASA_4302 (hemB)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASA_4302 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABO92226
UniProt: A4STK4
Position
complement(4604549..4605568)
Genome map
AA seq 339 aa AA seqDB search
MATTLPGAFPGRRLRRVRKHDFSRRLVRENVLTANDLIYPVFVLEGENRREAVTSMPGVD
RLSIDLLLAEAEELVALGVPAIALFPVTPLESKSLLAEEAYNPDGLAQRATRALKARFPE
LGVITDVALDPFTTHGQDGIIDDEGYVLNDITTDILVKQALSHAAAGADIVAPSDMMDGR
IGAIRAALEANGFINVQIMAYSAKYASCYYGPFRDAVGSAGNLGKSNKATYQMDPANSNE
ALHEVALDIQEGADSVMVKPGMPYLDVIRQVKDQFGVPTFAYQVSGEYAMHMAAIQNGWL
KEKESIMESLLCFKRAGADGILTYFAKRVAQWLQEDARR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctacaactcttccgggcgcctttccgggtcgccgtctgcgccgggtgcgcaaacat
gatttcagccgtcgtctggtgcgcgagaacgtactgaccgccaacgatctcatctatccc
gtgttcgtgctggagggggagaaccgtcgtgaggccgtcacctccatgccgggggtggat
cgtctctccatcgacctgctgctggcggaagccgaagagctggtcgccctcggcgtgccc
gccattgcgctcttcccggtgaccccgctggagagcaagagcctgttggcggaagaagct
tacaacccggacggtctggcccagcgggcgacccgcgccctcaaggctcgtttccccgag
ctgggggtcattacggacgtagcgctcgaccccttcaccacccatggccaggacggcatc
atagatgatgaaggctatgtgctgaacgacatcaccacggacatcctggtgaagcaggcg
ctttcccacgccgccgccggggccgatatcgttgcgccgtccgacatgatggatggccgc
atcggcgcgattcgcgccgcactggaagcgaacggcttcatcaatgtccagatcatggcc
tactccgccaagtatgcctcctgctactacggcccgttccgcgatgcggtgggctctgcc
ggcaacctcggcaagagcaacaaggccacctatcagatggatccggccaacagcaacgaa
gccctgcacgaagtggcgctggatattcaggaaggggctgacagcgtcatggtcaagccg
ggcatgccctacttggacgtgatccgtcaggtgaaggatcagttcggcgtgccgactttt
gcttatcaggtgagcggcgagtacgccatgcacatggcggcgatccagaacggctggctg
aaggagaaggagagcatcatggagtccctgctctgcttcaagcgagccggtgccgatggc
attctcacctacttcgccaaacgggttgcccagtggctgcaggaagacgccagacgctga

DBGET integrated database retrieval system