KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0035Help
Entry
RATSFB_0035       CDS       T01624                                 

Gene name
recR
Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RATSFB_0035 (recR)
DNA repair and recombination proteins [BR:asb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RATSFB_0035 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
45286..45885
Genome map
AA seq 199 aa AA seqDB search
MIEYPEYIQKVIGEFSKLPGVGYKTAVRLTMYMLNKEMKDVLDFCDSIKKCKEDLKYCKK
CNNFSENDICSICEDVGRDRRVICIVQDVKDIYAFEKTRNYRGLYYVLHGLISPIKGVSV
EDLKIDLLVKRVEEEKINEVILATSPTLEGEATSIYISKLFPKEQKLTRLAYGVPLGSDL
EYVDEITLSRALDFRQSIQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatatccagaatacatacaaaaagtcattggagagttttcgaaattaccgggg
gtaggatataaaacagcggtaagattaaccatgtatatgttaaataaggaaatgaaggat
gttttagacttttgtgattctataaaaaaatgtaaagaggatttaaaatattgtaaaaaa
tgtaacaatttttctgaaaatgatatttgctcgatctgtgaagatgtaggtagagatagg
cgagttatttgtattgtacaagatgtaaaagatatttatgcttttgaaaaaacgaggaat
tatagaggtttgtattatgtgttgcatggtttaatatctccgattaaaggagttagcgtg
gaagaccttaaaatagatttacttgttaagagagtagaagaagagaaaataaatgaggta
attttggcaacaagcccaactcttgaaggagaagcaactagtatttacatatctaaatta
tttccaaaagaacaaaagttgactagattggcgtatggagtgcctttgggaagtgattta
gaatatgttgatgaaattactttaagcagagctttagattttagacaaagtattcaataa

DBGET integrated database retrieval system