KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0082Help
Entry
RATSFB_0082       CDS       T01624                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:asb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104587..106428
Genome map
AA seq 613 aa AA seqDB search
MCGITGFSNFNKDITSEFNNIVMMNDSLYHRGPDEYDYYKHKNVVFGHRRLSIVDPDGGK
QPMQRVVNFHKYTIVYNGEIYNTNEIRDDLIDKGYRFSTYSDTEVVLINYIHYKENCVSR
LNGIFAFCIFDEDEKCLFIARDQLGVKPIFYSLKGGYLIFGSEMKSLLKHPKVSTDVYRE
GILDLLSLGPSRSPGEGIFRDIKEVPPAHYLCVYEDKVILKEYWNLESKEHNLTLEDTKE
KLSVMLEKVIKNQMVSDRGIFSFLSGGIDSSLISAIVSKELREKGEILDTFTVDYVDYDK
DFKGNEFEVTSDKYFVKLANESIKSNNRIITIKNEDLFYALERGLYASDIPSMADIDISL
YLFCNVIKNYGTVGLSGECADEIFGGYPWYLNDEDLKLNNFPWNRFSNIRKELFNDKIKS
LDFDSHVENRINETLKSVQFLDSDSEFDKKIRKMTTLNVKWFMVTLLNRKDRMSMANSLE
IRVPFADRELVEFSYNIPAKFKFLNGREKGILREASRKFLPYSIIDRKKSPYPKTQSNIY
RDLIMKELSRILDNKSNPIFEIIDEKSVRRLIESKGDSYTKPWFGQLMRGPQLMAYLIQI
NMWLKKYNINLYI
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaataacaggattttccaattttaataaagatataacaagtgaatttaacaat
atagtgatgatgaatgattctttgtatcatagaggaccagatgaatatgattattataaa
cataaaaatgtagtttttggacataggaggttatctatagttgatcctgatggaggcaaa
cagccaatgcaaagggttgttaattttcataagtatacaattgtatataatggagaaatt
tataacactaatgaaattagagatgatttaattgataaagggtacaggttttctacttat
tctgatacggaagttgttttgataaattatatacactataaagaaaattgtgtgagtagg
ttaaatggaatatttgcattttgtatttttgatgaggatgagaaatgtttatttatagct
agggatcagctgggggttaaacctattttttatagtttaaaaggtggatatttgattttt
ggatccgagatgaagtctttattaaaacatcctaaggttagtactgatgtttatcgtgag
ggtatacttgatcttttaagtttaggaccaagcagaagtcctggagaaggtatatttaga
gatataaaagaggttccaccagcacactatttatgtgtatatgaagataaagtaattctt
aaagaatactggaatcttgaatcaaaagagcataacttgactcttgaagataccaaagaa
aaattatctgtaatgcttgagaaggttataaagaatcaaatggtatcagataggggtatt
ttctcttttttgtcaggaggtatagactcatctcttatatctgctatagtgtctaaggag
cttagagaaaaaggggagattttagatacatttacagtagattatgttgattatgataag
gattttaaaggtaatgagtttgaggttacaagtgataaatattttgttaaactcgctaat
gaatctataaaatcaaataatagaatcattacaattaagaatgaagatttattttatgca
cttgagaggggactttatgcaagtgatattccttctatggctgatattgatatttcctta
tatttgttttgtaatgtgattaaaaattatggaactgttggattgtctggtgagtgtgca
gatgaaatatttggaggatatccttggtatttaaatgatgaggatttaaaattaaataat
ttcccttggaatagattctcaaacataagaaaagaactttttaatgataagattaaaagt
ttagattttgattctcatgttgaaaatagaataaatgaaacacttaaaagtgttcaattt
ttagatagcgatagtgagtttgataaaaaaataaggaaaatgactacactaaatgtaaaa
tggtttatggtaactttattgaatcgaaaagataggatgagtatggcaaatagtttagag
ataagagttcctttcgcagatagagagcttgttgagttttcctataacattccagctaaa
tttaaatttttaaatgggcgtgaaaaggggatattaagagaggcgagcagaaaatttttg
ccatactctataattgatagaaagaagagtccttatcctaaaactcagagcaacatatat
agagatcttattatgaaagaattatcgagaattttagataataaatctaatcctattttt
gaaattatagatgaaaaaagtgtaagaaggttaattgaaagtaaaggagattcttataca
aaaccttggtttggtcaacttatgagaggtccacagctcatggcttatttaatacaaatc
aatatgtggcttaaaaaatataatataaatttatatatatag

DBGET integrated database retrieval system