KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0084Help
Entry
RATSFB_0084       CDS       T01624                                 

Gene name
pfkA2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RATSFB_0084 (pfkA2)
   01230 Biosynthesis of amino acids
    RATSFB_0084 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_0084 (pfkA2)
   00030 Pentose phosphate pathway
    RATSFB_0084 (pfkA2)
   00051 Fructose and mannose metabolism
    RATSFB_0084 (pfkA2)
   00052 Galactose metabolism
    RATSFB_0084 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    RATSFB_0084 (pfkA2)
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RATSFB_0084 (pfkA2)
Protein phosphatases and associated proteins [BR:asb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RATSFB_0084 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110104..111066
Genome map
AA seq 320 aa AA seqDB search
MIKKIAILTSGGDAPGMNAAVRSVVRYALSRGIEVLGIHRGYHGLLHGEIESLTRKSVSD
IIDRGGTFLKTARCLEFKQEEVRAQAYEILKSHNVDGLVVVGGDGSFTGAHLLSKFGMST
VGIPGTIDNDLPYTDYTIGFDTALNTILDAVRKLRDTSSSHERVSIVEVMGRNCGDLALY
SALAGGAEAVIVPEYPFNREELCNVIVESKKNKKLHSLIILAEGAGEAEELRRYIQQKIG
LDTRATVLGHIQRGGIPTGRDRVLASVMGRKAVDTLLNNGICAKVIGVRENEVFDMDIEE
ALKVEKKFNKDLYDLVNKLA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagatagcgatattaacaagtggtggagatgctcctggaatgaacgcagct
gtaagatcagttgtgagatatgcattgagtagaggtatagaggttcttggtatacataga
ggataccatggacttttacatggtgagatagaatctctaactagaaaatctgtttctgat
attatagataggggaggaacttttttaaagaccgcaagatgtcttgaatttaagcaagaa
gaggttagagctcaggcatatgaaatattaaaaagtcataatgttgatggacttgtggtt
gtaggtggtgatggatcatttacaggagcacatttattatcaaaatttggtatgtccaca
gtaggtataccagggactatagataatgatcttccttatacagattatacaattggattt
gatacagcgctcaatactatattagatgctgtcagaaaattaagggatacatccagttct
catgaaagagttagtattgttgaagttatgggaagaaattgtggagatttagcattatat
tctgctcttgcaggtggtgctgaggctgtaattgtaccagaatatccgtttaatcgtgaa
gaattatgcaatgtcatagtggaatctaagaaaaataaaaagcttcatagtttaataatt
ttagcagaaggagcaggcgaggctgaggaacttagaaggtatatacaacaaaaaatagga
cttgatactagagctacagttcttgggcatatacaacgtggaggtataccaactggtcgt
gatagagttttagcatctgtaatgggtagaaaagctgtagatactcttttgaataatgga
atttgtgcaaaagttataggcgttagagaaaatgaagtatttgatatggatatagaagaa
gctttaaaagttgagaaaaaattcaataaagatttatatgatcttgttaataaattagct
taa

DBGET integrated database retrieval system