KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0126Help
Entry
RATSFB_0126       CDS       T01624                                 

Definition
putative sugar ABC transporter ATP-binding protein
Orthology
K02056  
simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Brite
Enzymes [BR:asb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     RATSFB_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161565..163079
Genome map
AA seq 504 aa AA seqDB search
MKVVEMKNITKRFPGMIANKNINFDLRKQEVHVLLGENGAGKTTLMNILYGIYNQDEGDI
FINGEKTKISTPKDAISKGIGMVHQHFMLVHNFTVAENIVLGHEPTKFKFIFDKSSVNEK
VEKLIDKYDFNIDLNSKIHDISVGQQQKVEILKMLYRGADIIILDEPTAVLTPDEIKELG
DIMNNLVNEGKSIILITHKLKEVMSMSDRVTIIRKGELIDTLNTEDTSIEELANLMVGRQ
VDLNVYTEKSKEFGNVLSIRNLMAKDNRGIDAIKGLNLDVKYGEIFGIIGVDGNGQSELV
EVLTGIRKCCGGEILFNGEDIKNLSAKDIINKNVVSIPEDRHKTGLVLQHSLYENSILGM
QHLSKFSKGIFLDYKKIRDHAKRIIEEFDVRTISDSVNASILSGGNQQKFIIGREIYKNP
KLIIAVQPTRGLDVGSIEYIHKRLIEERNNGKAILLISLELDEILSLSDRIGVIYNGNIP
RVLDRKEADENKIGILMAGGVFGG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgttgagatgaaaaatataactaaaagatttcctggtatgattgctaataaa
aatataaattttgacttaaggaaacaagaggtacatgttcttcttggagaaaacggggca
ggaaagacaactcttatgaatatcttatatggtatttataatcaagatgaaggggatatt
tttataaatggtgaaaaaacaaaaataagtacacctaaagatgctatatctaagggtatt
ggtatggttcatcaacattttatgttagtacataattttactgttgcagaaaatatagtt
cttggacatgaacctactaaatttaaatttatatttgataagagttctgtaaatgagaaa
gttgaaaaattaattgataaatatgattttaatatagatctaaatagtaaaatacatgat
atatctgtgggtcaacaacagaaagtagaaattttgaagatgctttatagaggagcagat
ataataatacttgatgaaccaactgctgtattaactcctgatgagataaaagagttggga
gatattatgaataatcttgttaatgaaggcaaatctattatacttattactcataaatta
aaagaggttatgagtatgagtgatagagtaacaattataagaaagggagaacttattgat
acattaaatacagaagatacatctatagaagaacttgcaaatcttatggtgggaagacag
gttgatttaaatgtgtatactgaaaagtcaaaggaatttggaaatgtattaagtattcga
aatttaatggcaaaagataatagaggtatagatgcgattaagggtttaaatttagatgtc
aagtatggagaaatatttggaattattggagttgatggtaacggacaaagtgaactcgta
gaagttttaactggtataaggaaatgttgtggaggtgagatattatttaatggagaggat
attaaaaatttatcagcaaaggatattataaataaaaatgtagtgagtataccagaggat
aggcataagacgggattagtacttcaacattctttgtatgaaaattcgattttaggaatg
caacacttaagtaaattttcaaaagggatttttcttgattataagaaaataagagatcat
gcaaaaagaattatagaggaatttgacgtgagaactataagtgatagtgtgaatgcttca
attttatctggaggtaatcagcaaaaatttataataggtagagaaatttataaaaatccc
aaacttataatagcagtgcaaccaactagagggctcgatgtaggatctattgaatatatt
cataagaggcttatagaggaaagaaataatggcaaagctattttattgatatcattagaa
cttgatgaaatattaagtttatctgataggataggagttatatataatgggaatattcct
agagttttagataggaaagaagcagatgagaataagatcggaatattgatggctggaggt
gtgtttggtgggtga

DBGET integrated database retrieval system