KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0132Help
Entry
RATSFB_0132       CDS       T01624                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RATSFB_0132 (tpiA)
   01230 Biosynthesis of amino acids
    RATSFB_0132 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_0132 (tpiA)
   00051 Fructose and mannose metabolism
    RATSFB_0132 (tpiA)
   00562 Inositol phosphate metabolism
    RATSFB_0132 (tpiA)
Enzymes [BR:asb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RATSFB_0132 (tpiA)
Exosome [BR:asb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RATSFB_0132 (tpiA)
  Exosomal proteins of bladder cancer cells
   RATSFB_0132 (tpiA)
  Exosomal proteins of melanoma cells
   RATSFB_0132 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168477..169232
Genome map
AA seq 251 aa AA seqDB search
MSFLRKNVIMGNWKMHFTVEETDKFLNKLIPKVKDAKTEVVVCVPFTSLALASNTLSGSN
IKLGAQNVHFEEQGAFTGEISPNMLKSVGVSHVLIGHSERRIYFGESDETVNKKIHTCLK
HGFVPVLCVGESLKEKEDGDMENILTNQIKNAFLNISSEDASKVVIAYEPIWAIGTGKTA
TSIDADNTISFIRKVVSSIYNKEISENMIMLYGGSVKPNTIKEQMSMENIDGALVGGASI
VVEDFERIVNF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttttttgagaaagaatgtaataatgggaaattggaaaatgcatttcacagttgag
gaaacagataaatttttaaataaattaattccgaaagttaaagatgctaaaactgaggtt
gttgtatgtgtcccatttacctctcttgcattagcttcaaatacacttagtggatcaaac
ataaagttaggagctcaaaatgtacactttgaagagcagggagcatttaccggtgaaatt
tctccaaatatgcttaaaagtgtaggagtttctcatgttttaataggacatagtgaaaga
aggatttactttggagagagtgatgaaactgttaataaaaaaattcatacttgcttaaaa
catggatttgttccagttttgtgtgttggagagagtttgaaggaaaaagaagatggtgat
atggaaaatatcctaacaaatcaaattaaaaatgcatttttaaatatatcaagtgaagat
gcaagcaaagttgtaattgcgtatgagccaatctgggctattggaactggtaaaacggct
acaagtattgacgctgataatacaatttctttcataagaaaggttgtaagcagtatttat
aataaggaaatatctgaaaatatgatcatgctatatggtggttcagttaagccaaatact
ataaaggaacaaatgtctatggagaatatagacggtgctttagttggtggagcttctata
gttgttgaagattttgagaggattgttaatttttag

DBGET integrated database retrieval system