KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0365Help
Entry
RATSFB_0365       CDS       T01624                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RATSFB_0365
   00670 One carbon pool by folate
    RATSFB_0365
Enzymes [BR:asb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RATSFB_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429702..430184)
Genome map
AA seq 160 aa AA seqDB search
MIKLIACIDKYNSLGINNELIYRIKEDLKIFKEKTIGNIIVMGRKTFNSLDNKPLSNRKN
IIISRNLCNPDNKSYIVFNDINDVLKLNTSKDIFIIGGNEIYKHFTPFYDEIHLTIIKNE
YTKLYPVNQSVKLNIDLTNFKLINQKEYNMFFINIYKKIN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagttaattgcatgcattgataaatacaattcactcggtataaataatgaactt
atttaccgcattaaagaagaccttaaaatatttaaggaaaaaactattggtaatataata
gttatgggtagaaaaactttcaatagtttagataataaacctctatcgaacaggaaaaat
ataattatttctcgtaatttatgtaacccagataacaaatcttatatagtttttaatgat
ataaatgatgttttaaaactaaatacatcaaaagatatttttataataggtggaaatgaa
atatataaacattttacacctttctatgacgaaatacatctaacaataataaaaaatgaa
tacactaaactctatcctgtaaaccaatctgtaaaattaaatatagacctaactaatttt
aaacttatcaatcaaaaagagtataatatgttctttataaatatatacaaaaaaattaat
taa

DBGET integrated database retrieval system