KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0400Help
Entry
RATSFB_0400       CDS       T01624                                 

Gene name
dxr2
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RATSFB_0400 (dxr2)
Enzymes [BR:asb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RATSFB_0400 (dxr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(471759..472910)
Genome map
AA seq 383 aa AA seqDB search
MKNISILGATGSIGIQSLDVIKNNPHKFKLNSISIGENIAELRKILKHFSPELVCLKNKN
DFERMRAEYPTIKFTYGNDGLLEIATFNKSNIIINGLVGNIGLLPTIHAIESHKNIALAN
KETLVTAGHIINQKVEEYNVDLIPIDSEHSAIFQALNGENHKSIKNLILTASGGSFRDKT
RDELKNVSIEDALKHPNWSMGAKITIDSATMANKGLEIIETHFLFNVDYQNIKVILHRES
IIHSMVEFDDSTIIAQLGTPDMRVPIQYALTYPDRIQNKDFKALNFEEISSLNFSKLDFE
RYPCVKMAFEAGKLGGTATTIFNSSNEEAVRLFLNKKISFLDIELLIEKSLSNYTIIENP
DLNTIIQLDKEVKSFVYEESKKI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttctattctaggagcaacaggatctattggaatacaatctcttgacgtt
ataaaaaacaatccacataaatttaaactaaattcaatttctataggagaaaatatagcg
gaacttagaaaaatcttaaaacatttttctcctgaacttgtatgtttaaaaaataaaaat
gattttgaacgtatgcgtgcggagtatccaactataaaattcacatacggaaatgatgga
ttgttagaaattgcaacatttaacaaatcaaatattatcataaacggtctagttggaaat
ataggactcttaccaactatacacgctatagaatcccataaaaatatagctctcgcaaat
aaggaaactcttgttacagcaggtcacataataaatcaaaaagttgaagaatacaatgtg
gatctcataccaatcgatagtgaacattccgccatattccaagccttaaacggtgaaaac
cataaaagtataaaaaacttaattttaacggcatctggtggaagttttagagataaaaca
agagatgaacttaaaaatgttagtattgaagatgcattaaaacacccaaattggtcaatg
ggtgcaaaaataacaatagattctgcaacaatggcaaacaaaggacttgaaataatcgaa
acacattttttattcaatgtagattatcagaacataaaggttatccttcatcgtgaaagc
attatacattcgatggttgaattcgatgattctactataatagctcaacttggaactccg
gatatgagagttcctattcagtacgctttaacatatcctgatagaatacaaaacaaagac
ttcaaagcattaaactttgaagaaatatcatcactaaatttttctaaattggattttgaa
agatatccttgtgtaaaaatggcatttgaagctggaaaacttggcggtactgcaacaaca
atatttaattcttcaaatgaagaagctgttagactatttttaaataaaaaaatctcattc
ttagatatagaacttctaattgaaaaatctttatctaactatacgattatagaaaatcca
gatttaaatacaattatccaattagataaagaagttaaatcatttgtttatgaagaatca
aaaaagatttaa

DBGET integrated database retrieval system