KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0461Help
Entry
RATSFB_0461       CDS       T01624                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RATSFB_0461
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RATSFB_0461
Enzymes [BR:asb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RATSFB_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554690..555901
Genome map
AA seq 403 aa AA seqDB search
MIFIIKTFLLMIFLSLFTINSCSYNRMMEEDLIQVKVNKPDEILEKINSMNLDEKIGQLF
IVGFDGESNLTQEDILLINDYKVSGFIFFRRNIQSSDQVVKLINEIKTINKNGSNIPMFL
SLDQEGGTVTRLPNEIIKFKSARDIGKINNEQYAYDTARVMGELVHSLGFNMNFAPVLDV
YTNPENTVIGSRAFSSDKEIVSKLAVATMKGLKDSGVIAVGKHYPGHGDTKEDSHYELPI
VNHDYERVKDIELYPFKMAIENGIDSILVSHLLYKNIDSENIATLSKVFLDDILMRELRF
RGIVITDDMIMNGLTKNNSITEACLKALQAGVDILLIGSGYQNIVDSINFIKNAVLNGEI
SEFEIEKKVYSVLKMKQKYNVNNDNVSKINVDEFNDKIRNLSY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatttttataataaagacgtttttattgatgatatttttaagtttatttactataaat
tcttgttcatataatcgtatgatggaagaagatttaattcaagtaaaagttaataagcct
gatgaaatattagaaaaaataaattctatgaatttagatgaaaagattggacaattattt
atagttggatttgatggagagtcaaatttgacacaagaagatattttgttaataaacgat
tacaaagtttctggatttatattttttaggagaaatattcaaagttctgatcaagttgtc
aaacttattaatgaaataaagactattaataaaaatggatctaatattccgatgtttctt
tctttggatcaagaaggagggactgttacaagacttcctaatgagattattaaatttaag
agtgcacgtgatattgggaaaataaataatgagcagtatgcttatgatactgcaagagtt
atgggtgagcttgtacatagtttaggatttaatatgaattttgctccagttttagatgtg
tatactaatcctgaaaatacagtcattgggtcaagagctttttctagtgataaagaaatt
gtatcaaaactagcagtagctacaatgaaaggacttaaggacagtggagttattgctgta
ggtaaacattatccaggacatggtgatacaaaagaggattcacattatgaattgcccata
gttaatcatgattatgaaagagttaaggatattgaattgtatccatttaagatggctata
gaaaatggcattgattcaattttggtatcacatttactttataaaaatattgattctgaa
aatattgccactttgtctaaggtttttttggatgatatacttatgagagaattaagattt
aggggaattgttataacagatgatatgataatgaatgggcttactaaaaataattctatt
actgaggcttgtcttaaggctcttcaagctggggttgatattttgttgataggatctggt
tatcaaaatattgtggattcaattaactttattaagaacgcagttttaaatggtgaaatt
tctgagtttgaaattgaaaaaaaggtttatagtgtattgaaaatgaaacaaaagtataat
gtgaataatgataacgtgtcaaaaattaatgtggatgaatttaatgacaaaataagaaat
ttatcttattaa

DBGET integrated database retrieval system