KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0494Help
Entry
RATSFB_0494       CDS       T01624                                 

Gene name
gpk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RATSFB_0494 (gpk)
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RATSFB_0494 (gpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584848..585465
Genome map
AA seq 205 aa AA seqDB search
MGEIYTKGLLIILSGPSGVGKGTICKELMKKYDYKVSISATTRTPREGEVDGVNYYFLDK
DVFKFKIKNNEFLEYAEVYGNYYGTLKSQVEEELDKGNNIILEIDIQGSMQVQKVFKNAV
YIFLLPPSINELKSRILKRGSETESSFNLRFSAVSEELKYMDSYDYAVINDDVDNAVERV
NGIIKTEMSRISRMNLEKFINGYVF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaatttatactaagggattattaattattctttctgggccttctggtgttgga
aaaggtacgatttgtaaagaacttatgaaaaaatatgattataaagtttcgatttctgct
actactaggactccaagagaaggagaagttgatggagttaattattattttttagataaa
gatgtttttaaatttaaaattaaaaataatgaatttttggaatatgctgaagtttacgga
aattattacggaacacttaaaagtcaagttgaagaggaattggataaaggaaataatatc
atactcgaaattgatattcaaggtagtatgcaagtgcagaaagtttttaaaaatgcagta
tacatatttttattgccaccatctataaatgagcttaaaagtagaattttaaagagaggt
agtgaaactgaatcttcgtttaacttgagattttctgcggttagtgaagaactaaaatac
atggacagctatgattatgccgttataaatgatgatgttgataatgcggttgaaagagta
aacggtataataaaaaccgaaatgagcagaataagtagaatgaatttagaaaaatttatt
aatggatatgttttctaa

DBGET integrated database retrieval system