KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_0653Help
Entry
RATSFB_0653       CDS       T01624                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RATSFB_0653 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_0653 (glk)
   00052 Galactose metabolism
    RATSFB_0653 (glk)
   00500 Starch and sucrose metabolism
    RATSFB_0653 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RATSFB_0653 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RATSFB_0653 (glk)
   00524 Butirosin and neomycin biosynthesis
    RATSFB_0653 (glk)
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RATSFB_0653 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(753718..754659)
Genome map
AA seq 313 aa AA seqDB search
MSNLYIGVDLGGTKIYTALCDKNGKFINEIILKTEAEKGEEQIVQKIKDSINYVMKDVDK
SKIKAIGIGSPGPLDIKNGLIAEPANLPFLNFPIVSTLFNEFNIDVYLDNDANVATLAEY
TFGSGKGTNNMLYITVSTGIGGGAILDGKIYRGSTSNALEIGHTTVAIHGRRCGCGNIGC
VEAMSSGTAMMKIARDAVSSRVETSLKNYENVTSKELFIEANKGDKVSLEIIETAMSYLG
VAVSNYTNILDPDLIIIGGGISESGDLMFNIIRNEMEKRCLGPIFRNCKIMKSNLGSKIG
VLGAIALAITESK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttgtatattggcgttgatttgggaggaacaaaaatttacactgctttatgc
gataaaaatggaaaatttattaatgaaataatattaaagacagaagcagaaaagggagaa
gaacaaatagtacaaaaaataaaagatagtattaactacgttatgaaagatgtagataaa
tctaaaataaaagcaataggtataggctctccaggtccattagatattaaaaatggatta
attgctgaacctgctaatttgccatttcttaatttccctatagttagtacattatttaat
gaattcaatatagatgtttatttagataatgatgcaaatgttgctactttagctgaatac
acatttggttctggaaaaggaacaaataatatgctttatattacagttagcacaggaata
ggaggaggtgctattttagatggaaaaatatatcgaggaagcacttcaaacgcactagaa
atcggacatacaacagtagctattcatggtagaagatgtggttgtggtaacattggctgt
gttgaagctatgtcatctggtactgctatgatgaaaatagcaagagatgccgtatcaagt
agagttgaaacttcattaaaaaattatgaaaatgtaacatcaaaagaattatttattgaa
gcaaataaaggtgataaagtttctttagaaataattgaaacagctatgagttatttaggt
gtagcagtgtcaaattataccaatatactagatccagatttaataataataggtggtgga
attagtgaaagtggtgatttgatgtttaatatcatcagaaacgaaatggaaaaaagatgc
ttggggccaatatttagaaattgcaagataatgaaatctaatttaggatcaaagattggg
gttttaggtgctattgcacttgccataacagaatctaaataa

DBGET integrated database retrieval system