KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1064Help
Entry
RATSFB_1064       CDS       T01624                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
asb00010  Glycolysis / Gluconeogenesis
asb00030  Pentose phosphate pathway
asb00051  Fructose and mannose metabolism
asb00052  Galactose metabolism
asb00680  Methane metabolism
asb01100  Metabolic pathways
asb01110  Biosynthesis of secondary metabolites
asb01120  Microbial metabolism in diverse environments
asb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_1064
   00030 Pentose phosphate pathway
    RATSFB_1064
   00051 Fructose and mannose metabolism
    RATSFB_1064
   00052 Galactose metabolism
    RATSFB_1064
  Energy metabolism
   00680 Methane metabolism
    RATSFB_1064
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RATSFB_1064
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RATSFB_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Phage_sheath_1 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: BAK81626
UniProt: G2IEQ2
Position
complement(1215605..1216699)
Genome map
AA seq 364 aa AA seqDB search
MNQIKKIAILTGGGDCPGLNAVIRAVTKTAILEYGYEVIGYRFGYRGLYNNDYMNLDISA
VDNILHKGGTILWSSNKDNLFDYVVEEDGQKVKKDVSDVAIENIKKENVDALVIVGGDGT
LTSARDFARKGVNVVGVPKTIDNDLGSTDFTFGFNTAIGIVTDCLDRLHTTAESHHRILI
AEVMGRNAGWIALHSGIAGDAHIILIPEIPYSLDKIIEKINERKAKGYKYTLIVVSEGAK
SISGETVIAKVVEDSPDPIRFGGIANKLASDLEKKISDQEVRSTILGHIQRGGNTSTYDR
VLSTRYGAAAARLIYEGKFGNMVCLNGDEISYIKLEDVIGNEKFVNPDHELVKISRSMGI
GFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaataaagaaaattgcgatacttacaggtggaggagactgtccaggtcttaat
gcagttataagagcagtaacaaaaacagctatattagaatatggatatgaagttataggg
tataggtttggatatagaggtttgtacaataatgattatatgaaccttgatattagtgca
gttgataatatcttacataaaggtggaactatactttggagttccaataaagataatctt
tttgattatgtagtagaagaagatggacaaaaggttaaaaaagatgtttcggacgttgcc
atcgaaaatataaaaaaggaaaatgtagatgccttagttatagttggtggagatggaact
ttaacatcagcaagagatttcgcacgaaagggtgttaatgttgtgggggttcctaagact
attgataatgatttagggtctacggattttacttttggttttaatacagcaataggaata
gttactgattgtttagatagacttcatacaacagctgaatctcatcatagaattttgata
gcagaagttatgggaaggaatgcgggatggattgcacttcattctggtattgccggtgat
gctcatataattttaatacctgagataccctatagtttggataaaattatagaaaagata
aatgagagaaaggctaaggggtataaatatactttaatagttgtgtctgaaggtgctaag
tctatttcgggagaaactgttattgcaaaagttgttgaagattcaccagatcctataaga
tttggaggaatagcaaacaagctcgcaagtgacttagagaagaaaatatctgaccaagaa
gttagatcaacaatacttggccatatccaaagaggaggaaacacttcaacatatgataga
gttttgtcaactaggtatggagcagcagcagctagacttatttatgaaggaaagtttgga
aatatggtttgcttaaatggtgatgaaatttcatatataaagcttgaagatgttattgga
aatgagaaatttgttaatcctgatcatgagttagtaaagatatctaggagtatggggatc
ggatttggagattaa

DBGET integrated database retrieval system