KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1064Help
Entry
RATSFB_1064       CDS       T01624                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_1064
   00030 Pentose phosphate pathway
    RATSFB_1064
   00051 Fructose and mannose metabolism
    RATSFB_1064
   00052 Galactose metabolism
    RATSFB_1064
  Energy metabolism
   00680 Methane metabolism
    RATSFB_1064
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RATSFB_1064
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RATSFB_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1215605..1216699)
Genome map
AA seq 364 aa AA seqDB search
MNQIKKIAILTGGGDCPGLNAVIRAVTKTAILEYGYEVIGYRFGYRGLYNNDYMNLDISA
VDNILHKGGTILWSSNKDNLFDYVVEEDGQKVKKDVSDVAIENIKKENVDALVIVGGDGT
LTSARDFARKGVNVVGVPKTIDNDLGSTDFTFGFNTAIGIVTDCLDRLHTTAESHHRILI
AEVMGRNAGWIALHSGIAGDAHIILIPEIPYSLDKIIEKINERKAKGYKYTLIVVSEGAK
SISGETVIAKVVEDSPDPIRFGGIANKLASDLEKKISDQEVRSTILGHIQRGGNTSTYDR
VLSTRYGAAAARLIYEGKFGNMVCLNGDEISYIKLEDVIGNEKFVNPDHELVKISRSMGI
GFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaataaagaaaattgcgatacttacaggtggaggagactgtccaggtcttaat
gcagttataagagcagtaacaaaaacagctatattagaatatggatatgaagttataggg
tataggtttggatatagaggtttgtacaataatgattatatgaaccttgatattagtgca
gttgataatatcttacataaaggtggaactatactttggagttccaataaagataatctt
tttgattatgtagtagaagaagatggacaaaaggttaaaaaagatgtttcggacgttgcc
atcgaaaatataaaaaaggaaaatgtagatgccttagttatagttggtggagatggaact
ttaacatcagcaagagatttcgcacgaaagggtgttaatgttgtgggggttcctaagact
attgataatgatttagggtctacggattttacttttggttttaatacagcaataggaata
gttactgattgtttagatagacttcatacaacagctgaatctcatcatagaattttgata
gcagaagttatgggaaggaatgcgggatggattgcacttcattctggtattgccggtgat
gctcatataattttaatacctgagataccctatagtttggataaaattatagaaaagata
aatgagagaaaggctaaggggtataaatatactttaatagttgtgtctgaaggtgctaag
tctatttcgggagaaactgttattgcaaaagttgttgaagattcaccagatcctataaga
tttggaggaatagcaaacaagctcgcaagtgacttagagaagaaaatatctgaccaagaa
gttagatcaacaatacttggccatatccaaagaggaggaaacacttcaacatatgataga
gttttgtcaactaggtatggagcagcagcagctagacttatttatgaaggaaagtttgga
aatatggtttgcttaaatggtgatgaaatttcatatataaagcttgaagatgttattgga
aatgagaaatttgttaatcctgatcatgagttagtaaagatatctaggagtatggggatc
ggatttggagattaa

DBGET integrated database retrieval system