KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1064Help
Entry
RATSFB_1064       CDS       T01624                                 

Definition
phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RATSFB_1064
   01230 Biosynthesis of amino acids
    RATSFB_1064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_1064
   00030 Pentose phosphate pathway
    RATSFB_1064
   00051 Fructose and mannose metabolism
    RATSFB_1064
   00052 Galactose metabolism
    RATSFB_1064
  Energy metabolism
   00680 Methane metabolism
    RATSFB_1064
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RATSFB_1064
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RATSFB_1064
Protein phosphatases and associated proteins [BR:asb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RATSFB_1064
Messenger RNA biogenesis [BR:asb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RATSFB_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1215605..1216699)
Genome map
AA seq 364 aa AA seqDB search
MNQIKKIAILTGGGDCPGLNAVIRAVTKTAILEYGYEVIGYRFGYRGLYNNDYMNLDISA
VDNILHKGGTILWSSNKDNLFDYVVEEDGQKVKKDVSDVAIENIKKENVDALVIVGGDGT
LTSARDFARKGVNVVGVPKTIDNDLGSTDFTFGFNTAIGIVTDCLDRLHTTAESHHRILI
AEVMGRNAGWIALHSGIAGDAHIILIPEIPYSLDKIIEKINERKAKGYKYTLIVVSEGAK
SISGETVIAKVVEDSPDPIRFGGIANKLASDLEKKISDQEVRSTILGHIQRGGNTSTYDR
VLSTRYGAAAARLIYEGKFGNMVCLNGDEISYIKLEDVIGNEKFVNPDHELVKISRSMGI
GFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaataaagaaaattgcgatacttacaggtggaggagactgtccaggtcttaat
gcagttataagagcagtaacaaaaacagctatattagaatatggatatgaagttataggg
tataggtttggatatagaggtttgtacaataatgattatatgaaccttgatattagtgca
gttgataatatcttacataaaggtggaactatactttggagttccaataaagataatctt
tttgattatgtagtagaagaagatggacaaaaggttaaaaaagatgtttcggacgttgcc
atcgaaaatataaaaaaggaaaatgtagatgccttagttatagttggtggagatggaact
ttaacatcagcaagagatttcgcacgaaagggtgttaatgttgtgggggttcctaagact
attgataatgatttagggtctacggattttacttttggttttaatacagcaataggaata
gttactgattgtttagatagacttcatacaacagctgaatctcatcatagaattttgata
gcagaagttatgggaaggaatgcgggatggattgcacttcattctggtattgccggtgat
gctcatataattttaatacctgagataccctatagtttggataaaattatagaaaagata
aatgagagaaaggctaaggggtataaatatactttaatagttgtgtctgaaggtgctaag
tctatttcgggagaaactgttattgcaaaagttgttgaagattcaccagatcctataaga
tttggaggaatagcaaacaagctcgcaagtgacttagagaagaaaatatctgaccaagaa
gttagatcaacaatacttggccatatccaaagaggaggaaacacttcaacatatgataga
gttttgtcaactaggtatggagcagcagcagctagacttatttatgaaggaaagtttgga
aatatggtttgcttaaatggtgatgaaatttcatatataaagcttgaagatgttattgga
aatgagaaatttgttaatcctgatcatgagttagtaaagatatctaggagtatggggatc
ggatttggagattaa

DBGET integrated database retrieval system