KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1172Help
Entry
RATSFB_1172       CDS       T01624                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RATSFB_1172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RATSFB_1172
   00620 Pyruvate metabolism
    RATSFB_1172
   00650 Butanoate metabolism
    RATSFB_1172
  Lipid metabolism
   00071 Fatty acid degradation
    RATSFB_1172
  Amino acid metabolism
   00350 Tyrosine metabolism
    RATSFB_1172
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RATSFB_1172
   00626 Naphthalene degradation
    RATSFB_1172
Enzymes [BR:asb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RATSFB_1172
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RATSFB_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355786..1358392
Genome map
AA seq 868 aa AA seqDB search
MKSKNQILEKEISNINSVINSLLDNAKKAEKKLLELNQEQIDKIVSSMCIAGASKNIELS
KLAVEETKRGVFEDKVIKNLFATEYIHHDIKHIKTVGIINDDPNKDYFNVAEPVGVIAGV
TPVTNPTSTAMFKAIISIKTRNPIVFAFHPSAQKCSSEAAKIVYDAAVSAGAPEHCIQWI
EEPSIEATNLLMNHPEISLILATGGSGMVKSAYSCGKPALGVGPGNVPAYLEKSCNLQRA
VSDIIISKTFDNGMICASEQAAIVDEEISKEFEKLMKNLNCHICSPDETKKVEKYAFPEE
KNSCVLNADIVGKPATQIAKEAGFEVPEKTKILITKIESIGANSPLSREKLSPILSYIIV
KNSDEGIEKAAQMVEFGGLGHSAAVHSSSEDVIRKFSEKVKAGRIVVNAPSTQGAIGDLY
NSNRASLTLGCGSYGKNSIISNVTCENLINLKRVARRKNNMQWFKVPKKIFFEWGSTSYL
EKMPDISKVMIITDPGMVNLGYTNIVLNHLNNRINKISVEIFSDVEPDPSVETVFNGVKA
MNRFKPDCIIALGGGSAIDAAKSMWLFYEHPEIDFNDIKLKFVDIRKRIYKFPKLGTKCQ
LVAIPTTSGTGSEVTSFSVISDKVKNIKYPLADYELTPNIAIIDPQFVMSLPKAVTADTG
LDVLTHAIEAYVSILASDYTDALALKSIHLVFEYLPRAFKNGNNDKVAREKMHNASSMAG
MAFTNAFLGINHSLAHKLGGEFHIPHGRANAILLPYVIKFNSETPTKLPSFPKYEKFIAD
KKYAEIARSLGLKASTTEEGVNSLIEAIKKLMNELEMPTRISECNIDKDEYMSKIELLAL
KAFDDQCTGANPRYPLVEELHEIYKSIY
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaaaatcaaatactagagaaagaaatttcaaatataaattcagttattaac
tccctactagataatgctaaaaaagctgaaaagaaacttttagaattaaatcaagaacaa
atagataaaattgtatcttctatgtgcatcgctggtgcaagtaaaaatatagaattatca
aaattagctgttgaagaaactaaacgtggagtttttgaagataaagttattaaaaacctt
tttgctactgaatatatacatcatgatattaaacatattaaaactgttggtattataaat
gatgatcctaacaaagactattttaatgttgctgaacctgttggtgttattgctggagtt
actcctgtcacaaacccaacatctactgctatgtttaaagctataatatcaattaaaaca
agaaatccaatagtgtttgcattccatccatctgcacaaaaatgtagctctgaggctgcc
aaaatagtttatgatgcagctgtatccgctggagctccagaacactgtattcagtggata
gaggaaccatctattgaagctactaacttacttatgaatcaccctgaaatatctcttatt
ttagcaacgggtggatctggaatggttaaatctgcatatagctgtggaaaacccgcttta
ggggttggacctggaaacgttcctgcttaccttgaaaaaagctgtaaccttcaaagagct
gtatcagatataataatatctaaaacttttgataatggtatgatttgtgcatctgaacaa
gctgctatagtagatgaggaaatttcaaaagaatttgaaaaattgatgaaaaatttaaat
tgccatatatgctctccagatgaaaccaaaaaagttgaaaaatatgcatttcctgaagaa
aagaattcttgtgtattaaatgctgatatagttggaaagcctgctacccaaatagctaaa
gaagcagggtttgaggttcctgaaaaaacaaaaatattaattacaaaaatagaatctata
ggagctaattcacctctatcacgtgaaaaattaagtcctatactttcatacattattgtt
aaaaactctgatgaaggaatagaaaaagctgctcaaatggtagaatttggaggtcttgga
cactctgcagctgttcattcatcaagtgaagatgttatcagaaaattctcagaaaaagtt
aaagctggaagaatagttgtaaatgcaccatcaactcaaggagctataggtgatttatat
aattcaaatagagcatctttaacacttggatgtggttcttacggcaaaaactcaataatt
tctaacgttacctgtgagaatttaatcaatttaaagagagtcgcaaggagaaaaaataat
atgcaatggtttaaggtacctaagaaaatattcttcgaatggggttctacttcgtattta
gaaaaaatgcctgatatatctaaagtaatgataatcactgaccctggaatggttaatctt
ggatatacaaacatagttttaaatcatttgaataacagaataaataaaataagcgttgaa
attttctctgacgttgaaccggatccatctgttgaaactgtatttaatggtgttaaagct
atgaacagatttaaacctgattgtataattgctttgggtggaggatctgcaatagatgct
gctaaatccatgtggttattctatgaacatccagaaatagacttcaatgatataaaatta
aaatttgttgatatcagaaagagaatttacaagttccctaaacttggtactaaatgtcaa
ttagtagcaatacctacaacatctggaacaggatcagaagttacatcattctcagtaatt
agtgataaagttaaaaatattaaatatcctctagctgattatgaattaactcctaatata
gctataatagatcctcaatttgttatgagcttaccaaaagctgtaacagcagatactgga
cttgatgttttaactcacgcaattgaagcatacgtttcaatacttgcatcagattataca
gatgcattagctcttaaatctatacatttagtatttgaatacttaccaagagcattcaaa
aatggaaataatgataaagttgctcgtgaaaaaatgcacaatgcatcttctatggctgga
atggcatttacaaatgcatttttaggaataaatcattcacttgctcacaaattaggaggg
gagttccatatacctcatggtcgtgcaaacgcaatacttttaccttatgtaattaaattt
aactctgaaacaccaacaaaactcccatcattccctaaatatgaaaagtttattgcagat
aagaaatatgcagaaattgcaagatctttaggacttaaagcttctactacagaagaaggt
gttaatagcttaattgaagctatcaaaaaattgatgaatgaacttgaaatgccaacaaga
atttccgaatgcaatattgataaagatgaatatatgagtaaaatagaattacttgctctt
aaagcatttgatgatcaatgtactggagcaaatccaagatacccccttgttgaagaacta
cacgaaatatacaaaagcatatactaa

DBGET integrated database retrieval system