KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1259Help
Entry
RATSFB_1259       CDS       T01624                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:asb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RATSFB_1259 (rbsK)
Enzymes [BR:asb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RATSFB_1259 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429076..1430005
Genome map
AA seq 309 aa AA seqDB search
MNKICVIGSLNMDLVLKINDIPKVGETILSKSYEKIAGGKGANQAIAAKRCGADVSMIAK
IGKDENGKILREKLKEENIDVTCIFKDDQDPTGLALIMVNKNGNNSIVVVPGSNMNITDK
EIDNSISKIINSDILIAQFETNENMTLKSFQKAKEFNKTTILNPAPAKKIDEKLLKLTDI
IIPNETEAEILTGIKINSIDDAKKAGEFFLNKGVKFSVITLGEKGALIVGRNFHELVHAF
KVNAVDTTAAGDSFIGALSSKLNFKNLNRETLKDAVSFGNKVSSITVQRKGAQPSIPYLE
EIKKIYKEN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatatgtgttattggaagtttaaacatggacctagttttgaaaattaacgat
ataccaaaggttggagaaactatactatccaaatcatatgaaaaaatagctggtggtaag
ggagcaaatcaggctattgctgctaaaagatgcggcgctgatgtatccatgatagctaaa
ataggaaaagatgaaaatggtaagatactaagagaaaagcttaaagaagaaaacatagat
gtaacttgtatttttaaagatgaccaagatccaactggacttgctttaatcatggtaaat
aaaaatggaaataattcaatagtagttgttcctggttcaaatatgaacattactgataaa
gagattgataactcaatttcaaaaattataaactcagatatactaatagcacaatttgaa
acaaatgaaaatatgactttaaaatcatttcaaaaagctaaggagtttaataaaacaact
atattaaacccagcaccagcaaaaaaaatagatgaaaaacttttaaagttaacagatatc
ataataccaaacgaaacagaagctgaaattttaacaggaattaaaataaattctattgat
gatgcaaagaaagcaggagaatttttcttaaataaaggtgttaaattttcagtaattacc
cttggggaaaagggagctctaattgtaggaagaaatttccatgaactagtacatgcgttt
aaagtaaatgcagtagatacaaccgcagctggtgatagttttataggcgctttatcctca
aaattaaattttaaaaatctaaatcgagaaacattaaaagatgctgtaagttttgggaat
aaagtatcttctataactgttcaaagaaaaggtgctcaaccatccataccttatcttgaa
gaaataaaaaagatttataaggagaattga

DBGET integrated database retrieval system