KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1324Help
Entry
RATSFB_1324       CDS       T01624                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:asb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:asb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1497204..1498490)
Genome map
AA seq 428 aa AA seqDB search
MEKIIINGSNPLYGSIEISGAKNAAVAVIPATVMCSEGICIIDNIPDIEDVNKLVRILKT
LGSSVRKVNNTLIIDNSNLKNYRADSDDVHNMRASYYLIGALLARFKKTIVDLPGGCSIG
DRPIDQHIKGLEKLGVNIRIEHGSVIAETDKLVGNNIFFDVVSVGATINVMLAACFADGV
TVLENVAKEPHVVDVANFLNLMGANIKGAGTDIIKITGVKRLLGCNYSIIPDQIEASTYM
MATAACTGEVLIKNVIPKHLESITAKLIEMGVTIFEYDDSILVKSTERLKGVNIKTAPYP
GFPTDVQQIIGVLMSISEGTSIISESIFENRFKYFDELKKMGVNVKIEGRAAIINGVDKL
TGCKLKATDLRAGAAMIIAGLVAKGTTEITSIKHIDRGYPNIEEKFRKLGANIYREYKDD
IKEFKNII
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattataataaatggatctaatccactttatggaagtatagaaattagtggt
gcgaaaaatgcagctgttgctgttataccagctacagttatgtgcagtgagggtatatgt
ataatagataatatacccgatatagaggatgttaataaactagtgagaattttaaaaaca
ttaggatctagtgtaagaaaggtaaataataccttaataatagataattcaaatttgaaa
aattatcgagctgatagtgatgatgtacataatatgagagcttcttattatttgatagga
gcattgttagcaagatttaaaaagacaattgtggatcttccaggaggatgtagtataggt
gatcgacctatagatcagcatataaaaggtttggaaaaacttggtgttaatattagaatt
gaacatggttcagtaattgctgaaacggataaattagttggcaacaatatattttttgat
gtagtaagtgtgggggcaactataaatgtaatgttagcggcatgctttgctgatggagtt
actgtgcttgaaaatgttgcaaaggaaccacatgttgtagacgtagcaaattttcttaat
ttgatgggtgctaatataaaaggtgcaggaacagatattataaaaataactggagtcaaa
agacttttagggtgtaattactcgataataccagatcaaatagaagcatctacatatatg
atggcaacggcagcttgtacgggagaggtattaattaaaaatgtaataccaaagcattta
gagtctataacagcaaaactaatagaaatgggtgtaactatttttgaatatgatgatagt
attttagtaaaaagtacggaacgtttaaaaggtgtaaatattaaaactgcaccgtatcca
ggatttcccactgatgtacagcaaataataggtgttcttatgagtatttctgaaggaaca
agtattataagtgaaagtatatttgaaaatagatttaagtattttgatgaactaaaaaaa
atgggagtaaatgttaagattgaaggaagagctgctattataaacggagtagataagctt
acaggatgtaaacttaaagctacagatttaagagccggtgctgctatgattatagcagga
ttagttgctaaagggaccacagagataacttcaataaagcatatagatagagggtatccc
aatatagaggaaaaatttagaaaattaggtgctaatatatatagagaatataaagatgat
ataaaagagtttaagaatataatatag

DBGET integrated database retrieval system